UniGene Name: sp_v3.0_unigene148526
Length: 238 nt
UniGene Fasta |
---|
>sp_v3.0_unigene148526
A |
Ace file of the UniGene sp_v3.0_unigene148526 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative rubisco activase [Oryza sativa Japonica Group] | - | - | 2.0e-35 | 87% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 61% |
Sma3 | Rubisco activase | - | - | 1.233e-27 | - |
Source | Gene names |
---|---|
Sma3 | 24K23.6; At1g73110; At1g73110/F3N23_39; At2g39730; CHLREDRAFT_128745; CHLREDRAFT_186089; F3N23.31; GSVIVT00018440001; GSVIVT00021361001; GSVIVT00024270001; GSVIVT00025198001; LOC_Os11g47970; MICPUCDRAFT_18274; MICPUCDRAFT_18586; MICPUCDRAFT_23296; MICPUCD |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | plastoglobule | GO:0010287 | Cellular Component | 0.0 | - |
Sma3 | protein complex | GO:0043234 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | ribulose-bisphosphate carboxylase activity | GO:0016984 | Molecular Function | 0.0 | - |
Sma3 | ADP binding | GO:0043531 | Molecular Function | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | WW/Rsp5/WWP | IPR001202 | - | 0.0 | - |
Sma3 | Rhodanese-like | IPR001763 | - | 0.0 | - |
Sma3 | ATPase, AAA-type, core | IPR003959 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G73110.1 | P-loop containing nucleoside triphosphate hydrolases superfamily protein chr1:27494344-27496844 REVERSE LENGTH=432 | 3.9937e-43 | 82% |
RefSeq | Arabidopsis thaliana | NP_177454.1 | putative Rubisco activase 2 [Arabidopsis thaliana] | 5.00264e-43 | 82% |
RefSeq | Populus trichocarpa | XP_002299165.1 | predicted protein [Populus trichocarpa] | 1.4013e-45 | 86% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NZT0
Fln msg: Distance to subject end: 40 aas, your sequence is shorter than subject: 79 - 363
Fln protein:
M
Protein Length:
80
Fln nts:
A
Fln Alignment:
HLKU4M001A07H1___TVNNQIVIGTLMNLADDPTRVSVGQDWKESDITNRVPIIVTGNDFSTLYAPLIRDGRMDKFYWQPTREDLINIVHQMY
A9NZT0________________TVNNQMVNATLMNIADNPTNVQLPGMYNKQD-NPRVPIVVTGNDFSTLYAPLIRDGRMEKFYWAPTRDDRIGVCQGIF
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain