|
||||||
|
UniGene Name: sp_v3.0_unigene148347
Length: 223 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene148347
G |
|
Ace file of the UniGene sp_v3.0_unigene148347 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Properoxidase n=4 Tax=Picea RepID=Q0JW35_PICAB | - | - | 4.0e-18 | 70% |
| FL-Next | tr=Properoxidase; Picea abies (Norway spruce) (Picea excelsa). | - | - | 0.0 | 70% |
| Sma3 | Peroxidase 72 | - | - | 1.042e-07 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peroxidase. | EC:1.11.1.7 | - | 1.959e-17 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylalanine metabolism | 00360 | 1.959e-17 | % | |
| Sma3 | Methane metabolism | 00680 | 1.959e-17 | % | |
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 1.959e-17 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.959e-17 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.959e-17 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.959e-17 | % |
| Source | Gene names |
|---|---|
| Sma3 | At2g18150; F8D23.7; OJ1167_G06.125; Os07g0677200; OsI_17703; OsI_27326; OsJ_16433; OsJ_25569; P15; PER15; PNC1; POD1; POPTRDRAFT_719600; POX22.3; POX4; RCOM_0533480; prx1; prx111; prx8; px1; px16; px17; pxc2; pxc6; spi2; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
| Sma3 | hydrogen peroxide catabolic process | GO:0042744 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Plant peroxidase | IPR000823 | - | 0.0 | - |
| Sma3 | Haem peroxidase, plant/fungal/bacterial | IPR002016 | - | 0.0 | - |
| Sma3 | Alpha-N-acetylglucosaminidase | IPR007781 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Sma3 | Peroxidase, active site | IPR019794 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G18150.1 | Peroxidase superfamily protein chr2:7892298-7893586 REVERSE LENGTH=338 | 6.0e-12 | 71% |
| RefSeq | Arabidopsis thaliana | NP_179407.1 | peroxidase 15 [Arabidopsis thaliana] | 8.0e-12 | 71% |
| RefSeq | Populus trichocarpa | XP_002327780.1 | predicted protein [Populus trichocarpa] | 2.0e-13 | 54% |
| Full-Lengther Next Prediction |
|---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: Q0JW35
Fln msg: Distance to subject end: 260 aas, atg_distance in limit (1-15): atg_distance = 7, your sequence is shorter than subject: 60 - 341
Fln protein:
M
Protein Length:
61
Fln nts:
G
Fln Alignment:
HLKU4M001CF7GC___TLQFHSVLIMG-ATLISVMVLDAKSCHGLSLHFYDTSCPEAEEIIKSVVKDAVDKEARMAASLLRLHFHD
Q0JW35________________TLQFLSVLITGLALMLWIQTVDAQSCNGLSHHFYYKSCPKAQAIIKSVVEDAVRKEARMAASLLRLHFHD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
