UniGene Name: sp_v3.0_unigene148174
Length: 172 nt
UniGene Fasta |
---|
>sp_v3.0_unigene148174
T |
Ace file of the UniGene sp_v3.0_unigene148174 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | AP2-like ethylene-responsive transcription factor [Arabidopsis thaliana] sp|Q94AN4.1|AP2L1_ARATH RecName: Full=AP2-like ethylene-responsive transcription factor At1g16060 gb|AAK76589.1| unknown protein [Arabidopsis thaliana] gb|AAM91814.1| unknown protein | - | - | 7.0e-07 | 68% |
FL-Next | tr=AINTEGUMENTA-like protein; Pinus thunbergii (Japanese black pine) (Pinus thunbergiana). | - | - | 0.0 | 72% |
Sma3 | AP2 domain-containing transcription factor | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 1.805e-08 | - |
Source | Gene names |
---|---|
Sma3 | 57h21.37; AIL1; AIL3; AIL4; AIL5; ANT; ANT1; AP2D14; AP2D17; AP2D4; AP2D8; ASML1; At1g16060; At1g51190; At1g72570; At1g79700; At3g20840; At3g54320; At4g37750; At5g17430; At5g57390; BBM; BBM1; BBM2; BNM3; CKC1; CrANTL1; DRG; F11M15.6; F28P22.24; GSVIVT0001 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | multicellular organismal development | GO:0007275 | Biological Process | 0.0 | - |
Sma3 | pattern specification process | GO:0007389 | Biological Process | 0.0 | - |
Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
Sma3 | seed germination | GO:0009845 | Biological Process | 0.0 | - |
Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
Sma3 | stem cell maintenance | GO:0019827 | Biological Process | 0.0 | - |
Sma3 | cell differentiation | GO:0030154 | Biological Process | 0.0 | - |
Sma3 | regulation of cell proliferation | GO:0042127 | Biological Process | 0.0 | - |
Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IPR000173 | - | 0.0 | - | |
Sma3 | AP2/ERF domain | IPR001471 | - | 0.0 | - |
Sma3 | Short-chain dehydrogenase/reductase SDR | IPR002198 | - | 0.0 | - |
Sma3 | Glucose/ribitol dehydrogenase | IPR002347 | - | 0.0 | - |
Sma3 | Zein-binding domain | IPR007656 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IIA, conserved site | IPR018522 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G16060.1 | ADAP ARIA-interacting double AP2 domain protein chr1:5508563-5511609 FORWARD LENGTH=345 | 9.0e-11 | 86% |
RefSeq | Arabidopsis thaliana | NP_973839.1 | AP2-like ethylene-responsive transcription factor [Arabidopsis thaliana] | 7.0e-11 | 86% |
RefSeq | Populus trichocarpa | XP_002325111.1 | AP2 domain-containing transcription factor [Populus trichocarpa] | 3.0e-11 | 94% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q76H96
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 249 aas, your sequence is shorter than subject: 39 - 606
Fln protein:
Y
Protein Length:
40
Fln nts:
T
Fln Alignment:
HLKU4M001AMKE1___YLGTYGTQEEXXXXXXXXXIEYRGLNAVTNFDLSRY
Q76H96________________YLGTFSTQEEAAEAYDIAAIKFRGISAVTNFDISKY
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain