UniGene Name: sp_v3.0_unigene148084
Length: 166 nt
UniGene Fasta |
---|
>sp_v3.0_unigene148084
T |
Ace file of the UniGene sp_v3.0_unigene148084 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Polyprotein, 3'-partial, putative (Fragment) n=1 Tax=Solanum demissum RepID=Q0KIP3_SOLDE | - | - | 3.0e-17 | 77% |
FL-Next | sp=RNA-directed DNA polymerase homolog; berteroana). Mitochondrion. | - | - | 0.0 | 65% |
Sma3 | Retrotransposon protein, putative, Ty3-gypsy subclass | - | - | 3.78995e-41 | - |
Source | Gene names |
---|---|
Sma3 | AT4g10580; At2g04670; At2g07660; At2g10780; B1160F02.12; B1160F02.4; H0211F06-OSIGBa0153M17.10; H0409D10.7; H0616A11.3; H0807C06-H0308C08.6; LOC_Os03g31930; LOC_Os03g32380; LOC_Os03g32960; LOC_Os03g33140; LOC_Os03g36290; LOC_Os03g42950; LOC_Os03g49330; LO |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chromatin | GO:0000785 | Cellular Component | 0.0 | - |
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | chromatin binding | GO:0003682 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | chromatin assembly or disassembly | GO:0006333 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Peptidase M14, carboxypeptidase A | IPR000834 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | Peptidase aspartic, active site | IPR001969 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Domain of unknown function DUF834 | IPR008552 | - | 0.0 | - |
Sma3 | Peptidase aspartic, catalytic | IPR009007 | - | 0.0 | - |
Sma3 | IPR013084 | - | 0.0 | - | |
Sma3 | Retroviral aspartyl protease | IPR013242 | - | 0.0 | - |
Sma3 | Zinc finger, H2C2-type, histone UAS binding | IPR015416 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Putative N-terminus
Fln database: sp_plants
Fln subject: P31843
Fln msg: Distance to subject end: 103 aas, Unexpected STOP codon in 5 prime region, your sequence is shorter than subject: 25 - 142
Fln protein:
L
Protein Length:
26
Fln nts:
T
Fln Alignment:
HLKU4M001BQARP___TLRLCIDFR*LNKVTIKNRYPLLRIDDLFNKL
P31843________________SLRMCIDYRALTKVTIKNKYPIPRVDDLFDRL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain