UniGene Name: sp_v3.0_unigene147891
Length: 196 nt
UniGene Fasta |
---|
>sp_v3.0_unigene147891
C |
Ace file of the UniGene sp_v3.0_unigene147891 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Integrase n=1 Tax=Populus trichocarpa RepID=Q0ZCD0_POPTR | - | - | 1.0e-15 | 62% |
FL-Next | tr=Putative uncharacterized protein; Vitis vinifera (Grape). | - | - | 0.0 | 60% |
Sma3 | Integrase | - | - | 7.781e-06 | - |
Source | Gene names |
---|---|
Sma3 | GSVIVT00005481001; GSVIVT00005553001; GSVIVT00008081001; GSVIVT00009118001; OSJNBb0021I10.3; OSJNBb0060M15.10; VITISV_000019; VITISV_000545; VITISV_001231; VITISV_002055; VITISV_002111; VITISV_002952; VITISV_003237; VITISV_003734; VITISV_003831; VITISV_00 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
Sma3 | transport | GO:0006810 | Biological Process | 0.0 | - |
Sma3 | DNA integration | GO:0015074 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Integrase, catalytic core | IPR001584 | - | 0.0 | - |
Sma3 | Zinc finger, CCHC-type | IPR001878 | - | 0.0 | - |
Sma3 | KID repeat | IPR003900 | - | 0.0 | - |
Sma3 | Transposon, En/Spm-like | IPR004242 | - | 0.0 | - |
Sma3 | Amino acid permease domain | IPR004841 | - | 0.0 | - |
Sma3 | Retrotransposon gag protein | IPR005162 | - | 0.0 | - |
Sma3 | Nitrite/sulphite reductase iron-sulphur/siroheam-binding site | IPR006066 | - | 0.0 | - |
Sma3 | Peptidase aspartic, catalytic | IPR009007 | - | 0.0 | - |
Sma3 | EGF-like region, conserved site | IPR013032 | - | 0.0 | - |
Sma3 | Homeobox, conserved site | IPR017970 | - | 0.0 | - |
Sma3 | DNA methylase, N-4 cytosine-specific, conserved site | IPR017985 | - | 0.0 | - |
Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: tr_plants
Fln subject: A5B055
Fln msg: Distance to subject end: 84 aas, your sequence is shorter than subject: 65 - 275
Fln protein:
Y
Protein Length:
66
Fln nts:
C
Fln Alignment:
HLKU4M001B7UJS___YRVLPFGLCNAPATFQRAILRIFSDLINEGLEVYMDDFTTYGDDFDPAFDTLEKVLQRCIATKL
A5B055________________YRRMPFGLCNAPATFQRCMLSIFSDMVERIMEVFMDDLTVYGKTFDDCLSNLKKVLKRCIANDL
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain