SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene147701

Length: 206 nt

UniGene Fasta

>sp_v3.0_unigene147701
CGCTGTGTGTCTCCATATGCAAAATGTTTCAGGTTCGAACGTTTGCATATGGAGACACACAGCGCCACACGGCTTTGTTTCCCTAAATTACATGCAGATCCCTGTGAACGCACCCAAATGTCCTAATTATAACAACCATCGGGACGGATTCGTGAACTTTGTGCACAGAGATGAGGAAGTGGATTACTTCCCACTCACGATACGAT

Ace file of the UniGene sp_v3.0_unigene147701

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Catalase n=3 Tax=Picea sitchensis RepID=A9NUY8_PICSI	-	-	2.0e-18	91%
FL-Next	sp=Catalase; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	87%
Sma3	Catalase	-	-	0.0	-

Source	ECs	Term	Type	e value	Identity
Sma3	Catalase.	EC:1.11.1.6	-	0.0	-

Source	KEGGs	Term	Identity
Sma3	Tryptophan metabolism	00380	%
Sma3	Methane metabolism	00680	%
Sma3	Metabolic pathways	01100	%

Source	Gene names
Sma3	AT4G35090; At1g20630; At4g35090; At4g35090/M4E13.140; CAT; CAT-1; CAT1; CAT2; CAT3; CAT4; CATA2; CATA3; CATA4; Cat1; Cat2; CatC; F2D10.11; F5M15.31; GCat; GSVIVT00004080001; GSVIVT00004081001; LOC_Os03g03910; M4E13.140; Os03g0131200; OsI_09857; OsJ_09293;

Source	GOs	Term	Type	Identity
Sma3	cell wall	GO:0005618	Cellular Component	-
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	peroxisome	GO:0005777	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	glyoxysome	GO:0009514	Cellular Component	-
Sma3	chloroplast envelope	GO:0009941	Cellular Component	-
Sma3	cytosolic ribosome	GO:0022626	Cellular Component	-
Sma3	catalase activity	GO:0004096	Molecular Function	-
Sma3	iron ion binding	GO:0005506	Molecular Function	-
Sma3	heme binding	GO:0020037	Molecular Function	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	cellular response to nitrogen starvation	GO:0006995	Biological Process	-
Sma3	response to light stimulus	GO:0009416	Biological Process	-
Sma3	response to abscisic acid stimulus	GO:0009737	Biological Process	-
Sma3	cellular response to sulfate starvation	GO:0009970	Biological Process	-
Sma3	cellular response to phosphate starvation	GO:0016036	Biological Process	-
Sma3	hydrogen peroxide catabolic process	GO:0042744	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Catalase haem-binding site	IPR002226	-	-
Sma3	Catalase immune-responsive domain	IPR010582	-	-
Sma3	Catalase core domain	IPR011614	-	-
Sma3	Catalase, mono-functional, haem-containing	IPR018028	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G20620.1	CAT3, SEN2, ATCAT3 catalase 3 chr1:7143142-7146193 FORWARD LENGTH=492	1.0e-15	66%
RefSeq	Arabidopsis thaliana	NP_564120.1	catalase 3 [Arabidopsis thaliana]	1.0e-15	66%
RefSeq	Populus trichocarpa	XP_002306976.1	catalase [Populus trichocarpa]	4.0e-15	72%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NUY8

Fln msg: Separated hits, possible frame ERROR between 68 and 86, Distance to subject end: 94 aas, your sequence is shorter than subject: 68 - 492

Fln protein: LCVSICKMFQVRTFAYGDTQRxxxxxxxNYMQIPVNAPKCPNYNNHRDGFVNFVHRDEEVDYFPLTIR

Protein Length: 69

Fln nts: CGCTGTGTGTCTCCATATGCAAAATGTTTCAGGTTCGAACGTTTGCATATGGAGACACACAGCGCCAxxxxxxxxxxxxxxxxxxAAATTACATGCAGATCCCTGTGAACGCACCCAAATGTCCTAATTATAACAACCATCGGGACGGATTCGTGAACTTTGTGCACAGAGATGAGGAAGTGGATTACTTCCCACTCACGATACGAT

Fln Alignment:

AllPine_a_rep_c122763___KMFQVRTFAYGDTQRHxxxxxxNYMQIPVNAPKCPNYNNHRDGFVNFVHRDEEVDYFP
A9NUY8________________KMFQTRTFAYADTQRHxxxxxxNYMQIPVNAPKCPHYNNHRDGFMNFLHRDEEVDYFP

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain