UniGene Name: sp_v3.0_unigene145254
Length: 199 nt
![]() |
---|
>sp_v3.0_unigene145254
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Pyruvate kinase n=2 Tax=Picea sitchensis RepID=A9NUL1_PICSI | - | - | 6.0e-20 | 86% |
FL-Next | sp=Pyruvate kinase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 86% |
Sma3 | Pyruvate kinase | - | - | 9.674e-30 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | EC:2.7.1.4- | - | 5.505e-35 | - |
Source | Gene names |
---|---|
Sma3 | AT3G52990; At2g36580; At3g52990; F8J2_160; GSVIVT00010811001; GSVIVT00021710001; LOC_Os11g05110; LOC_Os12g05110; MtrDRAFT_AC139525g8v2; Os11g0148500; Os12g0145700; OsI_35105; OsI_37456; OsJ_32969; OsJ_35209; PHYPADRAFT_109480; PHYPADRAFT_134756; PHYPADRAF |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
Sma3 | adenyl-nucleotide exchange factor activity | GO:0000774 | Molecular Function | 0.0 | - |
Sma3 | pyruvate kinase activity | GO:0004743 | Molecular Function | 0.0 | - |
Sma3 | potassium ion binding | GO:0030955 | Molecular Function | 0.0 | - |
Sma3 | protein homodimerization activity | GO:0042803 | Molecular Function | 0.0 | - |
Sma3 | chaperone binding | GO:0051087 | Molecular Function | 0.0 | - |
Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | GrpE nucleotide exchange factor | IPR000740 | - | 0.0 | - |
Sma3 | Pyruvate kinase | IPR001697 | - | 0.0 | - |
Sma3 | Pyruvate kinase, barrel | IPR015793 | - | 0.0 | - |
Sma3 | Pyruvate kinase, alpha/beta | IPR015794 | - | 0.0 | - |
Sma3 | Pyruvate/Phosphoenolpyruvate kinase | IPR015813 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G36580.1 | Pyruvate kinase family protein chr2:15339253-15342781 FORWARD LENGTH=527 | 2.0e-22 | 72% |
RefSeq | Arabidopsis thaliana | NP_565850.1 | pyruvate kinase-like protein [Arabidopsis thaliana] | 2.0e-22 | 72% |
RefSeq | Populus trichocarpa | XP_002316418.1 | predicted protein [Populus trichocarpa] | 2.0e-23 | 77% |
![]() |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: C0PRL0
Fln msg: query STOP codon is far from subject stop. Distance to subject end: 17 aas, your sequence is shorter than subject: 58 - 336
Fln protein:
V
Protein Length:
59
Fln nts:
C
Fln Alignment:
AllPine_a_rep_c117043___LVVRGVFPILADPRHPAESINATNESVLKIALDHGKTAGLIKPHDRIVV*PKNGNSAV
C0PRL0________________LIVRGVFPMLADPRHSAESINATNESVLEIALDHGKTAGLIKPHDRIVVCQKVGDSAV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain