UniGene Name: sp_v3.0_unigene145224
Length: 243 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
![]() |
---|
>sp_v3.0_unigene145224
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Phenylcoumaran benzylic ether reductase homolog TH6 n=4 Tax=Pinaceae RepID=Q9M523_TSUHE | - | - | 2.0e-35 | 93% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 96% |
Sma3 | Leucoanthocyanidin reductase | - | - | 5.621e-20 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Leucoanthocyanidin reductase. | EC:1.17.1.3 | - | 1.594e-17 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Flavonoid biosynthesis | 00941 | 1.594e-17 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.594e-17 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.594e-17 | % | |
Sma3 | Oxidoreductases, Acting on the CH-CH group of donors, With NAD(+) or NADP(+) as acceptor. | EC:1.3.1.- | - | 3.313e-11 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fatty acid biosynthesis | 00061 | 3.313e-11 | % | |
Sma3 | Phenylalanine metabolism | 00360 | 3.313e-11 | % | |
Sma3 | Chlorocyclohexane and chlorobenzene degradation | 00361 | 3.313e-11 | % | |
Sma3 | Fluorobenzoate degradation | 00364 | 3.313e-11 | % | |
Sma3 | Tryptophan metabolism | 00380 | 3.313e-11 | % | |
Sma3 | Xylene degradation | 00622 | 3.313e-11 | % | |
Sma3 | Toluene degradation | 00623 | 3.313e-11 | % | |
Sma3 | Polycyclic aromatic hydrocarbon degradation | 00624 | 3.313e-11 | % | |
Sma3 | Propanoate metabolism | 00640 | 3.313e-11 | % | |
Sma3 | Isoflavonoid biosynthesis | 00943 | 3.313e-11 | % | |
Sma3 | Biosynthesis of unsaturated fatty acids | 01040 | 3.313e-11 | % | |
Sma3 | Metabolic pathways | 01100 | 3.313e-11 | % | |
Sma3 | 2'-hydroxyisoflavone reductase. | EC:1.3.1.45 | - | 2.244e-29 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Isoflavonoid biosynthesis | 00943 | 2.244e-29 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 2.244e-29 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 2.244e-29 | % |
Source | Gene names |
---|---|
Sma3 | A622; A622L; AT4g39230; At1g75280; At1g75290; At1g75300; At1g75300/F22H5_16; At4g39230; BETV6; BETV6.0102; DDCBER1; EGS1; F22H5.16; F22H5.17; F22H5.18; GSVIVT00011864001; GSVIVT00014594001; GSVIVT00017628001; GSVIVT00019233001; GSVIVT00023330001; GSVIVT00 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
Sma3 | transcription repressor activity | GO:0016564 | Molecular Function | 0.0 | - |
Sma3 | leucoanthocyanidin reductase activity | GO:0033788 | Molecular Function | 0.0 | - |
Sma3 | 2'-hydroxyisoflavone reductase activity | GO:0047526 | Molecular Function | 0.0 | - |
Sma3 | regulation of nitrogen utilization | GO:0006808 | Biological Process | 0.0 | - |
Sma3 | response to oxidative stress | GO:0006979 | Biological Process | 0.0 | - |
Sma3 | phenylpropanoid metabolic process | GO:0009698 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cecropin | IPR000875 | - | 0.0 | - |
Sma3 | NmrA-like | IPR008030 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Sma3 | Cyclic nucleotide-binding, conserved site | IPR018488 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G75300.1 | NmrA-like negative transcriptional regulator family protein chr1:28255552-28256927 FORWARD LENGTH=322 | 1.0e-29 | 67% |
RefSeq | Arabidopsis thaliana | NP_177665.1 | NmrA-like negative transcriptional regulator-like protein [Arabidopsis thaliana] | 2.0e-29 | 67% |
RefSeq | Populus trichocarpa | XP_002330574.1 | phenylcoumaran benzylic ether reductase 4 [Populus trichocarpa] | 7.0e-33 | 75% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NVX5
Fln msg: Distance to subject end: 150 aas, your sequence is shorter than subject: 81 - 307
Fln protein:
V
Protein Length:
82
Fln nts:
G
Fln Alignment:
AllPine_a_rep_c116973___VDVVISAVKGPQLTDQLNIIKAIKEVGTIKRFLPSEFGNDVDKTHAVEPAKTMFATKAKIRRAIEEEGIPYTYVSSNCFA
A9NVX5________________VDVVISAVKGPQLTDQLNIIKAIKEVGTIKRFLPSEFGNDVDKTHAVEPAKTMFASKAKIRRAIEAEGIPYTFVSSNCFA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain