SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene145224

Length: 243 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene145224
GTTGATGTTGTTATCTCAGCTGTAAAGGGACCACAGTTGACGGATCAGCTGAATATCATCAAGGCCATTAAGGAGGTTGGAACCATCAAGAGGTTTCTGCCATCTGAGTTTGGGAATGATGTCGATAAAACCCATGCAGTGGAGCCTGCAAAGACTATGTTTGCTACCAAAGCGAAAATTCGCAGGGCCATTGAGGAAGAAGGTATCCCTTACACATATGTCTCTAGCAACTGTTTTGCTCGG

Ace file of the UniGene sp_v3.0_unigene145224 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Phenylcoumaran benzylic ether reductase homolog TH6 n=4 Tax=Pinaceae RepID=Q9M523_TSUHE	-	-	2.0e-35	93%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	96%
Sma3	Leucoanthocyanidin reductase	-	-	5.621e-20	-

Source	ECs	Term	Type	e value	Identity
Sma3	Leucoanthocyanidin reductase.	EC:1.17.1.3	-	1.594e-17	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Flavonoid biosynthesis	00941		1.594e-17	%
Sma3	Biosynthesis of phenylpropanoids	01061		1.594e-17	%
Sma3	Biosynthesis of secondary metabolites	01110		1.594e-17	%
Sma3	Oxidoreductases, Acting on the CH-CH group of donors, With NAD(+) or NADP(+) as acceptor.	EC:1.3.1.-	-	3.313e-11	-

Source	KEGGs	Term	Type	e value	Identity
Sma3	Fatty acid biosynthesis	00061		3.313e-11	%
Sma3	Phenylalanine metabolism	00360		3.313e-11	%
Sma3	Chlorocyclohexane and chlorobenzene degradation	00361		3.313e-11	%
Sma3	Fluorobenzoate degradation	00364		3.313e-11	%
Sma3	Tryptophan metabolism	00380		3.313e-11	%
Sma3	Xylene degradation	00622		3.313e-11	%
Sma3	Toluene degradation	00623		3.313e-11	%
Sma3	Polycyclic aromatic hydrocarbon degradation	00624		3.313e-11	%
Sma3	Propanoate metabolism	00640		3.313e-11	%
Sma3	Isoflavonoid biosynthesis	00943		3.313e-11	%
Sma3	Biosynthesis of unsaturated fatty acids	01040		3.313e-11	%
Sma3	Metabolic pathways	01100		3.313e-11	%
Sma3	2'-hydroxyisoflavone reductase.	EC:1.3.1.45	-	2.244e-29	-

Source	KEGGs	Term	e value	Identity
Sma3	Isoflavonoid biosynthesis	00943	2.244e-29	%
Sma3	Biosynthesis of phenylpropanoids	01061	2.244e-29	%
Sma3	Biosynthesis of secondary metabolites	01110	2.244e-29	%

Source	Gene names
Sma3	A622; A622L; AT4g39230; At1g75280; At1g75290; At1g75300; At1g75300/F22H5_16; At4g39230; BETV6; BETV6.0102; DDCBER1; EGS1; F22H5.16; F22H5.17; F22H5.18; GSVIVT00011864001; GSVIVT00014594001; GSVIVT00017628001; GSVIVT00019233001; GSVIVT00023330001; GSVIVT00

Source	GOs	Term	Type	Identity
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	catalytic activity	GO:0003824	Molecular Function	-
Sma3	binding	GO:0005488	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	transcription repressor activity	GO:0016564	Molecular Function	-
Sma3	leucoanthocyanidin reductase activity	GO:0033788	Molecular Function	-
Sma3	2'-hydroxyisoflavone reductase activity	GO:0047526	Molecular Function	-
Sma3	regulation of nitrogen utilization	GO:0006808	Biological Process	-
Sma3	response to oxidative stress	GO:0006979	Biological Process	-
Sma3	phenylpropanoid metabolic process	GO:0009698	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-
Sma3	oxidation-reduction process	GO:0055114	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Cecropin	IPR000875	-	-
Sma3	NmrA-like	IPR008030	-	-
Sma3	NAD(P)-binding domain	IPR016040	-	-
Sma3	Cyclic nucleotide-binding, conserved site	IPR018488	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G75300.1	NmrA-like negative transcriptional regulator family protein chr1:28255552-28256927 FORWARD LENGTH=322	1.0e-29	67%
RefSeq	Arabidopsis thaliana	NP_177665.1	NmrA-like negative transcriptional regulator-like protein [Arabidopsis thaliana]	2.0e-29	67%
RefSeq	Populus trichocarpa	XP_002330574.1	phenylcoumaran benzylic ether reductase 4 [Populus trichocarpa]	7.0e-33	75%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NVX5

Fln msg: Distance to subject end: 150 aas, your sequence is shorter than subject: 81 - 307

Fln protein: VDVVISAVKGPQLTDQLNIIKAIKEVGTIKRFLPSEFGNDVDKTHAVEPAKTMFATKAKIRRAIEEEGIPYTYVSSNCFAR

Protein Length: 82

Fln nts: GTTGATGTTGTTATCTCAGCTGTAAAGGGACCACAGTTGACGGATCAGCTGAATATCATCAAGGCCATTAAGGAGGTTGGAACCATCAAGAGGTTTCTGCCATCTGAGTTTGGGAATGATGTCGATAAAACCCATGCAGTGGAGCCTGCAAAGACTATGTTTGCTACCAAAGCGAAAATTCGCAGGGCCATTGAGGAAGAAGGTATCCCTTACACATATGTCTCTAGCAACTGTTTTGCTCGG

Fln Alignment:

AllPine_a_rep_c116973___VDVVISAVKGPQLTDQLNIIKAIKEVGTIKRFLPSEFGNDVDKTHAVEPAKTMFATKAKIRRAIEEEGIPYTYVSSNCFA
A9NVX5________________VDVVISAVKGPQLTDQLNIIKAIKEVGTIKRFLPSEFGNDVDKTHAVEPAKTMFASKAKIRRAIEAEGIPYTFVSSNCFA

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain