UniGene Name: sp_v3.0_unigene144947
Length: 234 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene144947
C |
Ace file of the UniGene sp_v3.0_unigene144947 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Thaumatin-like protein [Arabidopsis thaliana] gb|AEE29691.1| Thaumatin-like protein [Arabidopsis thaliana] | - | - | 5.0e-20 | 68% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 83% |
| Sma3 | Thaumatin-like protein | - | - | 6.724e-34 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G20030; AT1G75800; AT4g24180; AT4g38660; AT4g38670; At1g18250; At1g19320; At1g20030; At1g73620; At1g73620/F25P22_3; At1g75040; At1g75050; At1g75800; At4g24180; At4g38660; At4g38670; At4g38670/F20M13_230; BFTP; Cry j 3.5; F20M13.220; F20M13.230; F25P22. |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | anchored to membrane | GO:0031225 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | IgE binding | GO:0019863 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | glucan endo-1,3-beta-D-glucosidase activity | GO:0042973 | Molecular Function | 0.0 | - |
| Sma3 | defense response | GO:0006952 | Biological Process | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | response to biotic stimulus | GO:0009607 | Biological Process | 0.0 | - |
| Sma3 | systemic acquired resistance | GO:0009627 | Biological Process | 0.0 | - |
| Sma3 | response to UV-B | GO:0010224 | Biological Process | 0.0 | - |
| Sma3 | regulation of anthocyanin biosynthetic process | GO:0031540 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
| Sma3 | Inositol monophosphatase | IPR000760 | - | 0.0 | - |
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Thaumatin, pathogenesis-related | IPR001938 | - | 0.0 | - |
| Sma3 | Proteinase inhibitor I2, Kunitz metazoa | IPR002223 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | 3(2),5 -bisphosphate nucleotidase HAL2 | IPR006239 | - | 0.0 | - |
| Sma3 | IPR006670 | - | 0.0 | - | |
| Sma3 | Cyclin, N-terminal | IPR006671 | - | 0.0 | - |
| Sma3 | Cyclin-like | IPR013763 | - | 0.0 | - |
| Sma3 | Cyclin D | IPR015451 | - | 0.0 | - |
| Sma3 | Thaumatin, conserved site | IPR017949 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - | |
| Sma3 | Peptidase S1/S6, chymotrypsin/Hap, active site | IPR018114 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G18250.2 | - | 3.0e-22 | 68% |
| RefSeq | Arabidopsis thaliana | NP_001031064.1 | Thaumatin-like protein [Arabidopsis thaliana] | 4.0e-22 | 68% |
| RefSeq | Populus trichocarpa | XP_002322099.1 | predicted protein [Populus trichocarpa] | 7.0e-23 | 70% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NYU8
Fln msg: Overlapping hits, possible frame ERROR between 59 and 53, Distance to subject end: 96 aas, your sequence is shorter than subject: 77 - 243
Fln protein:
E
Protein Length:
78
Fln nts:
C
Fln Alignment:
AllPine_a_rep_c116082___WSGRIWGRHGCSFDNTxxGVCATGDCGGQLQCNGAGGAPPATLAEFTLGTQDFYDVKGLVGGYNLPIAKATRKGSG
A9NYU8________________WSGRIWGRHGCSFDSDxxGLCATGDCGGQLHCNGAGGAPPATLAEITLGTQDFYDV-SLVDGYNLPIAIAPRRGSG

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)