|
||||||
|
UniGene Name: sp_v3.0_unigene144033
Length: 193 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene144033
T |
|
Ace file of the UniGene sp_v3.0_unigene144033 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Alcohol dehydrogenase (Fragment) n=1 Tax=Pinus banksiana RepID=Q43300_PINBN | - | - | 2.0e-17 | 100% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
| Sma3 | Alcohol dehydrogenase | - | - | 2.209e-36 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alcohol dehydrogenase. | EC:1.1.1.1 | - | 4.357e-29 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 4.357e-29 | % | |
| Sma3 | Fatty acid metabolism | 00071 | 4.357e-29 | % | |
| Sma3 | Glycine, serine and threonine metabolism | 00260 | 4.357e-29 | % | |
| Sma3 | Tyrosine metabolism | 00350 | 4.357e-29 | % | |
| Sma3 | Chloroalkane and chloroalkene degradation | 00625 | 4.357e-29 | % | |
| Sma3 | Naphthalene degradation | 00626 | 4.357e-29 | % | |
| Sma3 | Retinol metabolism | 00830 | 4.357e-29 | % | |
| Sma3 | Metabolism of xenobiotics by cytochrome P450 | 00980 | 4.357e-29 | % | |
| Sma3 | Drug metabolism - cytochrome P450 | 00982 | 4.357e-29 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.357e-29 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 4.357e-29 | % | |
| Sma3 | S-(hydroxymethyl)glutathione dehydrogenase. | EC:1.1.1.284 | - | 6.716e-06 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Methane metabolism | 00680 | 6.716e-06 | % |
| Source | Gene names |
|---|---|
| Sma3 | ADH; ADH1; ADH2; ADH3; Adh; Adh1; Adh2; Adh3; Adh4; AdhC1; AdhC2; AdhC3; AdhC4; AdhC5; AdhC6; AdhC7; Dadh-B; LOC_Os11g10520; OA_CBa016E12-6; OB_Ba045I08-6; OG_ABa077F15_032P05-5; OO_Ba194G19-2; OP_Ba004F03-2; OR_BBa102H20-2; OSI9Ba083O10_092B13-3; Os11g02 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | alcohol dehydrogenase (NAD) activity | GO:0004022 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alcohol dehydrogenase superfamily, zinc-type | IPR002085 | - | 0.0 | - |
| Sma3 | Alcohol dehydrogenase, zinc-type, conserved site | IPR002328 | - | 0.0 | - |
| Sma3 | Alcohol dehydrogenase, C-terminal | IPR013149 | - | 0.0 | - |
| Sma3 | Alcohol dehydrogenase GroES-like | IPR013154 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G77120.1 | ADH1, ADH, ATADH, ATADH1 alcohol dehydrogenase 1 chr1:28975509-28977216 FORWARD LENGTH=379 | 3.0e-14 | 65% |
| RefSeq | Arabidopsis thaliana | NP_177837.1 | alcohol dehydrogenase class-P [Arabidopsis thaliana] | 3.0e-14 | 65% |
| RefSeq | Populus trichocarpa | XP_002328463.1 | predicted protein, partial [Populus trichocarpa] | 3.0e-15 | 65% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NQ91
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 18 aas, your sequence is shorter than subject: 58 - 103
Fln protein:
H
Protein Length:
59
Fln nts:
T
Fln Alignment:
AllPine_a_rep_c113033___HSDAVFQTSPLNFLTERTLKGTFYGNYKPRSDLPGLVEMYLAK
A9NQ91________________HSDAVFATSPLNFLSERTLKGTFFGNYKPRSDLPGLVELYLDK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
