UniGene Name: sp_v3.0_unigene143655
Length: 195 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene143655
G |
Ace file of the UniGene sp_v3.0_unigene143655 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Predicted protein n=2 Tax=Hordeum vulgare RepID=F2E6C9_HORVD | - | - | 4.0e-27 | 98% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 98% |
| Sma3 | Autoinhibited calcium ATPase | - | - | 1.523e-37 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Calcium-transporting ATPase. | EC:3.6.3.8 | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | ACA1; ACA10; ACA11; ACA12; ACA13; ACA2; ACA3; ACA4; ACA5; ACA6; ACA7; ACA8; ACA9; AT1G10130; AT5G57110; ATPase1-2B; ATPse2-2B; A_TM018A10.4; At1g07670; At1g07810; At1g10130; At1g27770; At2g22950; At2g41560; At3g21180; At3g22910; At3g57330; At3g63380; At3g |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plant-type vacuole | GO:0000325 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | vacuolar membrane | GO:0005774 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum | GO:0005783 | Cellular Component | 0.0 | - |
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | Golgi apparatus | GO:0005794 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast inner membrane | GO:0009706 | Cellular Component | 0.0 | - |
| Sma3 | endomembrane system | GO:0012505 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | flagellum | GO:0019861 | Cellular Component | 0.0 | - |
| Sma3 | integral to endoplasmic reticulum membrane | GO:0030176 | Cellular Component | 0.0 | - |
| Sma3 | late endosome membrane | GO:0031902 | Cellular Component | 0.0 | - |
| Sma3 | magnesium ion binding | GO:0000287 | Molecular Function | 0.0 | - |
| Sma3 | damaged DNA binding | GO:0003684 | Molecular Function | 0.0 | - |
| Sma3 | DNA-directed DNA polymerase activity | GO:0003887 | Molecular Function | 0.0 | - |
| Sma3 | peroxidase activity | GO:0004601 | Molecular Function | 0.0 | - |
| Sma3 | calcium channel activity | GO:0005262 | Molecular Function | 0.0 | - |
| Sma3 | calcium-transporting ATPase activity | GO:0005388 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | calmodulin binding | GO:0005516 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | monovalent inorganic cation transmembrane transporter activity | GO:0015077 | Molecular Function | 0.0 | - |
| Sma3 | manganese-transporting ATPase activity | GO:0015410 | Molecular Function | 0.0 | - |
| Sma3 | ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism | GO:0015662 | Molecular Function | 0.0 | - |
| Sma3 | protein self-association | GO:0043621 | Molecular Function | 0.0 | - |
| Sma3 | DNA repair | GO:0006281 | Biological Process | 0.0 | - |
| Sma3 | ATP biosynthetic process | GO:0006754 | Biological Process | 0.0 | - |
| Sma3 | cation transport | GO:0006812 | Biological Process | 0.0 | - |
| Sma3 | calcium ion transport | GO:0006816 | Biological Process | 0.0 | - |
| Sma3 | manganese ion transport | GO:0006828 | Biological Process | 0.0 | - |
| Sma3 | single fertilization | GO:0007338 | Biological Process | 0.0 | - |
| Sma3 | pollen development | GO:0009555 | Biological Process | 0.0 | - |
| Sma3 | response to nematode | GO:0009624 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | monovalent inorganic cation transport | GO:0015672 | Biological Process | 0.0 | - |
| Sma3 | inflorescence morphogenesis | GO:0048281 | Biological Process | 0.0 | - |
| Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
| Sma3 | shoot development | GO:0048367 | Biological Process | 0.0 | - |
| Sma3 | manganese ion homeostasis | GO:0055071 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G57110.1 | ACA8, AT-ACA8 autoinhibited Ca2+ -ATPase, isoform 8 chr5:23109729-23116857 REVERSE LENGTH=1074 | 9.0e-33 | 95% |
| RefSeq | Arabidopsis thaliana | NP_851200.1 | calcium-transporting ATPase 8 [Arabidopsis thaliana] | 1.0e-32 | 95% |
| RefSeq | Populus trichocarpa | XP_002309001.1 | autoinhibited calcium ATPase [Populus trichocarpa] | 2.0e-34 | 98% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AEG4
Fln msg: Distance to subject end: 249 aas, your sequence is shorter than subject: 65 - 387
Fln protein:
G
Protein Length:
66
Fln nts:
G
Fln Alignment:
AllPine_a_rep_c111574___GHVVAVTGDGTNDAPALKEADIGLSMGIQGTEVAKESSDIIILDDNFASVVKVVRWGRSVYAN
D5AEG4________________GHVVAVTGDGTNDAPALHEADIGLSMGIQGTEVAKESSDIIILDDNFASVVKVVRWGRSVYAN

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)