SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene143109

Length: 253 nt

UniGene Fasta

>sp_v3.0_unigene143109
CGTCGTGACCTTGGCTGTCACTCATTGGCTTTGGCTGGCAAGCTCGATTCAGAATTAAGAGTATCCGGTTCTGTGACATATGATGGGCACAAACTAAGAGAGTTCGTGCCCCAGAGAACATCGGCTTACATTAGCCAACATGATTTACATATTGGTGAAATGACTGTGCGAGAAACTATGGACTTCTCTGGCCGATGTCAAGGGGTTGGAACCAGATATGACAAGTTAGTTGAGCTTTCTAGAAGAGAAAAAC

Ace file of the UniGene sp_v3.0_unigene143109

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	ABCG subfamily transporter n=2 Tax=Solanum tuberosum RepID=F5C1T7_SOLTU	-	-	3.0e-29	80%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	71%
Sma3	ATP-binding cassette transporter, putative	-	-	0.0	-

Source	ECs	Term	Type	e value	Identity
Sma3	Phosphonate-transporting ATPase.	EC:3.6.3.28	-	0.0	-
Sma3	Heme-transporting ATPase.	EC:3.6.3.41	-	9.453e-11	-

Source	Gene names
Sma3	ABC1; At1g15210; At1g15520; At1g59870; At1g66950; At2g26910; At2g29940; At2g36380; At2g37280; At3g16340; At3g30842; At3g53480; At4g15215; At4g15220/At4g15230; At4g15233; At4g15236; B1045F02.15; B1090H08.39; F12C20.5; F1O11.1; F1O19.3; F23F1.14; F23H11.19;

Source	GOs	Term	Type	Identity
Sma3	mitochondrion	GO:0005739	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	chloroplast	GO:0009507	Cellular Component	-
Sma3	chloroplast envelope	GO:0009941	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	nucleotide binding	GO:0000166	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	cadmium ion transmembrane transporter activity	GO:0015086	Molecular Function	-
Sma3	ATPase activity	GO:0016887	Molecular Function	-
Sma3	nucleoside-triphosphatase activity	GO:0017111	Molecular Function	-
Sma3	protein dimerization activity	GO:0046983	Molecular Function	-
Sma3	transport	GO:0006810	Biological Process	-
Sma3	defense response	GO:0006952	Biological Process	-
Sma3	response to biotic stimulus	GO:0009607	Biological Process	-
Sma3	systemic acquired resistance	GO:0009627	Biological Process	-
Sma3	response to ethylene stimulus	GO:0009723	Biological Process	-
Sma3	response to salicylic acid stimulus	GO:0009751	Biological Process	-
Sma3	response to jasmonic acid stimulus	GO:0009753	Biological Process	-
Sma3	defense response to fungus, incompatible interaction	GO:0009817	Biological Process	-
Sma3	response to ozone	GO:0010193	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	cadmium ion transport	GO:0015691	Biological Process	-
Sma3	lead ion transport	GO:0015692	Biological Process	-
Sma3	negative regulation of defense response	GO:0031348	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	Ribosomal protein L11	IPR000911	-	-
Sma3	Legume lectin domain	IPR001220	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Proteinase inhibitor I2, Kunitz metazoa	IPR002223	-	-
Sma3	ABC transporter-like	IPR003439	-	-
Sma3	AAA+ ATPase domain	IPR003593	-	-
Sma3	Zinc finger, BED-type predicted	IPR003656	-	-
Sma3	ATPase, AAA-type, core	IPR003959	-	-
Sma3	Pleiotropic drug resistance protein PDR	IPR005285	-	-
Sma3	Phosphopantetheine attachment site	IPR006162	-	-
Sma3	HAT dimerisation	IPR008906	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	ABC-2 type transporter	IPR013525	-	-
Sma3	Plant PDR ABC transporter associated	IPR013581	-	-
Sma3		IPR015706	-	-
Sma3	ABC transporter, conserved site	IPR017871	-	-
Sma3	Peptidase S26A, signal peptidase I, serine active site	IPR019756	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT3G16340.1	ATPDR1, PDR1 pleiotropic drug resistance 1 chr3:5539897-5546263 FORWARD LENGTH=1416	4.0e-32	75%
RefSeq	Arabidopsis thaliana	NP_001189911.1	ABC transporter G family member 29 [Arabidopsis thaliana]	5.0e-32	75%
RefSeq	Populus trichocarpa	XP_002298123.1	pleiotropic drug resistance, ABC transporter family protein, partial [Populus trichocarpa]	7.0e-34	78%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LN70

Fln msg: Distance to subject end: 171 aas, your sequence is shorter than subject: 84 - 443

Fln protein: RRDLGCHSLALAGKLDSELRVSGSVTYDGHKLREFVPQRTSAYISQHDLHIGEMTVRETMDFSGRCQGVGTRYDKLVELSRREK

Protein Length: 85

Fln nts: CGTCGTGACCTTGGCTGTCACTCATTGGCTTTGGCTGGCAAGCTCGATTCAGAATTAAGAGTATCCGGTTCTGTGACATATGATGGGCACAAACTAAGAGAGTTCGTGCCCCAGAGAACATCGGCTTACATTAGCCAACATGATTTACATATTGGTGAAATGACTGTGCGAGAAACTATGGACTTCTCTGGCCGATGTCAAGGGGTTGGAACCAGATATGACAAGTTAGTTGAGCTTTCTAGAAGAGAAAAAC

Fln Alignment:

AllPine_a_rep_c109510___LALAGKLDSELRVSGSVTYDGHKLREFVPQRTSAYISQHDLHIGEMTVRETMDFSGRCQGVGTRYDKLVELSRREK
B8LN70________________LALTGKLQNTLKVEGEVKYNGHALNEFVPERTSTYISQHDTHMGELTVRETLNFSARCQGVGSRYDVLTELSRREK

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain