|
||||||
|
UniGene Name: sp_v3.0_unigene142184
Length: 242 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene142184
A |
|
Ace file of the UniGene sp_v3.0_unigene142184
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Pectinesterase n=1 Tax=Picea sitchensis RepID=A9NVV0_PICSI | - | - | 3.0e-32 | 88% |
| FL-Next | sp=Pectinesterase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
| Sma3 | Pectinesterase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pectinesterase. | EC:3.1.1.11 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pentose and glucuronate interconversions | 00040 | 0.0 | % | |
| Sma3 | Starch and sucrose metabolism | 00500 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | ARATH1; ARATH20; ARATH22; ARATH24; ARATH25; ARATH32; ARATH34; ARATH38; ARATH4; ARATH41; ARATH44; ARATH46; ARATH47; ARATH54; ARATH56; ARATH59; ARATH60; ARATH61; AT3G10720; At1g02810; At1g11370; At1g11580; At2g47550; At3g05620; At3g10710; At3g10720; At3g432 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | enzyme inhibitor activity | GO:0004857 | Molecular Function | 0.0 | - |
| Sma3 | pectinesterase activity | GO:0030599 | Molecular Function | 0.0 | - |
| Sma3 | aspartyl esterase activity | GO:0045330 | Molecular Function | 0.0 | - |
| Sma3 | fruit ripening | GO:0009835 | Biological Process | 0.0 | - |
| Sma3 | cell wall modification | GO:0042545 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pectinesterase, catalytic | IPR000070 | - | 0.0 | - |
| Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
| Sma3 | Pectinesterase inhibitor | IPR006501 | - | 0.0 | - |
| Sma3 | Pectin lyase fold | IPR012334 | - | 0.0 | - |
| Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
| Sma3 | Pectinesterase, active site | IPR018040 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G02330.1 | ATPMEPCRB Plant invertase/pectin methylesterase inhibitor superfamily chr4:1032479-1034928 FORWARD LENGTH=573 | 1.0e-24 | 66% |
| RefSeq | Arabidopsis thaliana | NP_567227.1 | pectinesterase 41 [Arabidopsis thaliana] | 2.0e-24 | 66% |
| RefSeq | Populus trichocarpa | XP_002317208.1 | predicted protein [Populus trichocarpa] | 3.0e-25 | 75% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NVV0
Fln msg: Warning!, your query overlaps and the subject is separated, Distance to subject end: 101 aas, your sequence is shorter than subject: 81 - 557
Fln protein:
N
Protein Length:
82
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c106021___NVLFRCKIAAYQDTLYAHSLRQFYRECNILGTVDFIFGNAAxxxxxxxxxxxxxGMPQKNAITAQGRTDPNQNTGTSIHNCKITPDADLVPVKSSFP
A9NVV0________________SVLYRCKIAAYQDTLYAHSLRQFYRECKISGTVDFIFGNAAxxxxxxxxxxxxxGANQKNAITAQGRTDPNQNTGISIHNCKITPGTDLVPVKSSFP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
