|
||||||
|
UniGene Name: sp_v3.0_unigene142163
Length: 173 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene142163
A |
|
Ace file of the UniGene sp_v3.0_unigene142163
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Acyl-CoA oxidase (Fragment) n=1 Tax=Phaseolus vulgaris RepID=Q1KSH8_PHAVU | - | - | 6.0e-16 | 78% |
| FL-Next | sp=Acyl-coenzyme A oxidase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 62% |
| Sma3 | Acyl-CoA oxidase | - | - | 1.095e-14 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Acyl-CoA oxidase. | EC:1.3.3.6 | - | 1.118e-13 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Fatty acid metabolism | 00071 | 1.118e-13 | % | |
| Sma3 | alpha-Linolenic acid metabolism | 00592 | 1.118e-13 | % | |
| Sma3 | Biosynthesis of unsaturated fatty acids | 01040 | 1.118e-13 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 1.118e-13 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.118e-13 | % |
| Source | Gene names |
|---|---|
| Sma3 | ACAD; ACX1; ACX1.2; Acx1A; Acx1B; At2g35690; At4g16760; FCAALL.119; GSVIVT00013479001; OSJNBa0075G19.29-1; Os06g0103500; OsI_21277; OsJ_19813; PHYPADRAFT_221246; POPTRDRAFT_646132; POPTRDRAFT_836303; RCOM_1119640; T20F21.12; VITISV_000871; dl4405c; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | peroxisome | GO:0005777 | Cellular Component | 0.0 | - |
| Sma3 | acyl-CoA dehydrogenase activity | GO:0003995 | Molecular Function | 0.0 | - |
| Sma3 | acyl-CoA oxidase activity | GO:0003997 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
| Sma3 | long-chain fatty acid metabolic process | GO:0001676 | Biological Process | 0.0 | - |
| Sma3 | fatty acid beta-oxidation | GO:0006635 | Biological Process | 0.0 | - |
| Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Acyl-CoA oxidase, C-terminal | IPR002655 | - | 0.0 | - |
| Sma3 | Acyl-CoA oxidase/dehydrogenase, type 1 | IPR006090 | - | 0.0 | - |
| Sma3 | Acyl-CoA oxidase/dehydrogenase, central domain | IPR006091 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | Acyl-CoA oxidase | IPR012258 | - | 0.0 | - |
| Sma3 | IPR013764 | - | 0.0 | - | |
| Sma3 | Acyl-CoA dehydrogenase/oxidase, N-terminal | IPR013786 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G16760.1 | ACX1, ATACX1 acyl-CoA oxidase 1 chr4:9424930-9428689 REVERSE LENGTH=664 | 2.0e-14 | 62% |
| RefSeq | Arabidopsis thaliana | NP_001190744.1 | peroxisomal acyl-coenzyme A oxidase 1 [Arabidopsis thaliana] | 2.0e-14 | 62% |
| RefSeq | Populus trichocarpa | XP_002326656.1 | predicted protein [Populus trichocarpa] | 1.0e-17 | 64% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NUR5
Fln msg: Distance to subject end: 94 aas, your sequence is shorter than subject: 57 - 660
Fln protein:
M
Protein Length:
58
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c105953___LSSELVDVARAHCELIVVSKFIEKVQQDIPGEGIKHQLELLCSVYALSLL
A9NUR5________________LSVNLVSVAQAHCQLIVLSKFIDKVHGAIPGLNVKKQLQLLCNTYGLSLV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
