|
||||||
|
UniGene Name: sp_v3.0_unigene142011
Length: 184 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene142011
C |
|
Ace file of the UniGene sp_v3.0_unigene142011
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | RecName: Full=Pyruvate dehydrogenase E1 component subunit alpha, mitochondrial; Short=PDHE1-A; Flags: Precursor emb|CAA81558.1| E1 alpha subunit of pyruvate dehydrogenase precursor [Solanum tuberosum] | - | - | 6.0e-12 | 71% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 84% |
| Sma3 | PDHE1-A | - | - | 8.409e-17 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pyruvate dehydrogenase (acetyl-transferring). | EC:1.2.4.1 | - | 3.353e-18 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glycolysis / Gluconeogenesis | 00010 | 3.353e-18 | % | |
| Sma3 | Citrate cycle (TCA cycle) | 00020 | 3.353e-18 | % | |
| Sma3 | Valine, leucine and isoleucine biosynthesis | 00290 | 3.353e-18 | % | |
| Sma3 | Pyruvate metabolism | 00620 | 3.353e-18 | % | |
| Sma3 | Butanoate metabolism | 00650 | 3.353e-18 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 3.353e-18 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 3.353e-18 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 3.353e-18 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 3.353e-18 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 3.353e-18 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 3.353e-18 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 3.353e-18 | % | |
| Sma3 | Metabolic pathways | 01100 | 3.353e-18 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 3.353e-18 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT1G59900; At1g24180; At1g59900; E1aPDH; F23H11.21; F3I6.11; GSVIVT00025274001; IAR4; OJ1136_C11.8; Os02g0739600; Os06g0246500; OsI_22361; OsJ_08320; OsJ_20802; P0684F11.25; PDH E1a-1; PDH E1a-2; PHYPADRAFT_123902; POPTRDRAFT_657555; RCOM_0699730; VITISV_ |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrial matrix | GO:0005759 | Cellular Component | 0.0 | - |
| Sma3 | intracellular membrane-bounded organelle | GO:0043231 | Cellular Component | 0.0 | - |
| Sma3 | pyruvate dehydrogenase (acetyl-transferring) activity | GO:0004739 | Molecular Function | 0.0 | - |
| Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Dehydrogenase, E1 component | IPR001017 | - | 0.0 | - |
| Sma3 | Sugar transporter, conserved site | IPR005829 | - | 0.0 | - |
| Sma3 | Pyruvate dehydrogenase (acetyl-transferring) E1 component, alpha subunit, subgroup y | IPR017597 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G24180.1 | IAR4 Thiamin diphosphate-binding fold (THDP-binding) superfamily protein chr1:8560777-8563382 REVERSE LENGTH=393 | 7.0e-15 | 65% |
| RefSeq | Arabidopsis thaliana | NP_173828.1 | pyruvate dehydrogenase E1 component subunit alpha-2 [Arabidopsis thaliana] | 9.0e-15 | 65% |
| RefSeq | Populus trichocarpa | XP_002311788.1 | predicted protein [Populus trichocarpa] | 7.0e-16 | 65% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NWY7
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 19 aas, your sequence is shorter than subject: 60 - 400
Fln protein:
S
Protein Length:
61
Fln nts:
C
Fln Alignment:
AllPine_a_rep_c105593___VRKLVLANNIATAAELKDIEKEAKKEVDDAIALAKQESPLPDPSDLFAHVYV
A9NWY7________________VRKLVLAHNIATPAELKDIEKEAKKEVDDAIALAK-ECSLPDSSELFSHVYV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
