UniGene Name: sp_v3.0_unigene141904
Length: 148 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene141904
A |
Ace file of the UniGene sp_v3.0_unigene141904
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Beta-galactosidase n=1 Tax=Picea sitchensis RepID=B8LLU8_PICSI | - | - | 4.0e-13 | 94% |
| FL-Next | sp=Beta-galactosidase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 94% |
| Sma3 | Beta-galactosidase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Beta-galactosidase. | EC:3.2.1.23 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Galactose metabolism | 00052 | 0.0 | % | |
| Sma3 | Other glycan degradation | 00511 | 0.0 | % | |
| Sma3 | Glycosaminoglycan degradation | 00531 | 0.0 | % | |
| Sma3 | Sphingolipid metabolism | 00600 | 0.0 | % | |
| Sma3 | Glycosphingolipid biosynthesis - ganglio series | 00604 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | AT3G13750; At1g45130; At3g13750; At3g52840; At4g36360; BG1; BGAL1; BGAL2; BGAL3; BGAL5; C7A10.1000; F23E13.200; F27F5.20; F8J2.10; GAL1; GAL2; GSVIVT00016563001; GSVIVT00024515001; GSVIVT00034164001; GSVIVT00036860001; JP-GAL; LOC_Os01g39830; MMM17.1; Os0 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | beta-galactosidase complex | GO:0009341 | Cellular Component | 0.0 | - |
| Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | beta-galactosidase activity | GO:0004565 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor | GO:0016616 | Molecular Function | 0.0 | - |
| Sma3 | cation binding | GO:0043169 | Molecular Function | 0.0 | - |
| Sma3 | coenzyme binding | GO:0050662 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | coenzyme A metabolic process | GO:0015936 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
| Sma3 | D-galactoside/L-rhamnose binding SUEL lectin domain | IPR000922 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 35 | IPR001944 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, family 2, N-terminal | IPR006104 | - | 0.0 | - |
| Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | WD40 repeat, conserved site | IPR019775 | - | 0.0 | - |
| Sma3 | Peroxidases heam-ligand binding site | IPR019793 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G13750.1 | BGAL1 beta galactosidase 1 chr3:4511192-4515756 FORWARD LENGTH=847 | 6.0e-15 | 75% |
| RefSeq | Arabidopsis thaliana | NP_187988.1 | beta galactosidase 1 [Arabidopsis thaliana] | 7.0e-15 | 75% |
| RefSeq | Populus trichocarpa | XP_002329051.1 | predicted protein [Populus trichocarpa] | 2.0e-14 | 75% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLU8
Fln msg: Distance to subject end: 114 aas, your sequence is shorter than subject: 49 - 836
Fln protein:
M
Protein Length:
50
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c105277___RWYHVPRSWLQPSGNVLVLFEEIGGNPSGVSLVRRSV
B8LLU8________________RWYHVPRSWLQPSGNTLVLFEEIGGNPSGVSLVTRSV

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta