|
||||||
|
UniGene Name: sp_v3.0_unigene141739
Length: 143 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene141739
G |
|
Ace file of the UniGene sp_v3.0_unigene141739
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | protein kinase-like protein [Arabidopsis thaliana] gb|AAG51561.1|AC027034_7 protein kinase, putative; 86372-89112 [Arabidopsis thaliana] gb|AAL36319.1| putative protein kinase [Arabidopsis thaliana] gb|AAM20044.1| putative protein kinase [Arabidopsis thal | - | - | 1.0e-08 | 68% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 88% |
| Sma3 | ATP binding protein, putative | - | - | 4.938e-19 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Non-specific protein-tyrosine kinase. | EC:2.7.10.2 | - | 4.084e-16 | - |
| Sma3 | Mitogen-activated protein kinase kinase kinase. | EC:2.7.11.25 | - | 1.866e-07 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT1G07650; AT3G13690; At1g11050; At1g16670; At1g26150; At1g29730; At1g68690; At3g13690; At5g02800; B1065E10.29; B1085F01.22; B1153E06.9; F19K19.4; F1N18.20; F1N18.21; F24B9.29; F24J5.8; F28B23.17; F8K4.7; F9G14_110; GSVIVT00002759001; GSVIVT00002761001; G |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
| Sma3 | aspartic-type endopeptidase activity | GO:0004190 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | zinc ion binding | GO:0008270 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G55200.1 | Protein kinase protein with adenine nucleotide alpha hydrolases-like domain chr1:20589309-20592049 REVERSE LENGTH=676 | 9.0e-13 | 68% |
| RefSeq | Arabidopsis thaliana | NP_175916.1 | protein kinase-like protein [Arabidopsis thaliana] | 1.0e-12 | 68% |
| RefSeq | Populus trichocarpa | XP_002301677.1 | predicted protein [Populus trichocarpa] | 4.0e-13 | 76% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PPW7
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 132 aas, your sequence is shorter than subject: 47 - 702
Fln protein:
S
Protein Length:
48
Fln nts:
G
Fln Alignment:
AllPine_a_rep_c104841___GYMAPEYAFRGQLTEKADVFSFGVLLLEIVSGRKAQ
C0PPW7________________GYMAPEYALRGQLTEKADVFSFGVLVLEIISGRKNQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
