UniGene Name: sp_v3.0_unigene141693
Length: 235 nt
![]() |
---|
>sp_v3.0_unigene141693
A |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Chaperonin 60 alpha subunit (Fragment) n=2 Tax=fabids RepID=E3NYT8_9FABA | - | - | 4.0e-16 | 61% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 76% |
Sma3 | CPN-60 alpha | - | - | 6.309e-22 | - |
Source | Gene names |
---|---|
Sma3 | AT1G55490; AT5G56500; At1g55490; At2g28000; At3g13470; At5g18820; At5g56500; CHLREDRAFT_24547; CPN60A; GSVIVT00022204001; GSVIVT00024837001; GSVIVT00030157001; GSVIVT00034341001; LOC_Os03g64210; LOC_Os12g17910; MtrDRAFT_AC147481g39v2; OSJNBa0033P04.2; Os0 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleolus | GO:0005730 | Cellular Component | 0.0 | - |
Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | thylakoid | GO:0009579 | Cellular Component | 0.0 | - |
Sma3 | chloroplast envelope | GO:0009941 | Cellular Component | 0.0 | - |
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | cytosolic ribosome | GO:0022626 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
Sma3 | cell death | GO:0008219 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | systemic acquired resistance | GO:0009627 | Biological Process | 0.0 | - |
Sma3 | cellular protein metabolic process | GO:0044267 | Biological Process | 0.0 | - |
Sma3 | chaperone mediated protein folding requiring cofactor | GO:0051085 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Zinc finger, DHHC-type, palmitoyltransferase | IPR001594 | - | 0.0 | - |
Sma3 | Chaperonin Cpn60 | IPR001844 | - | 0.0 | - |
Sma3 | Chaperonin Cpn60/TCP-1 | IPR002423 | - | 0.0 | - |
Sma3 | Chaperone, tailless complex polypeptide 1 | IPR017998 | - | 0.0 | - |
Sma3 | Chaperonin Cpn60, conserved site | IPR018370 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G28000.1 | CPN60A, CH-CPN60A, SLP chaperonin-60alpha chr2:11926603-11929184 FORWARD LENGTH=586 | 3.0e-20 | 77% |
RefSeq | Arabidopsis thaliana | NP_180367.1 | chaperonin-60alpha [Arabidopsis thaliana] | 3.0e-20 | 77% |
RefSeq | Populus trichocarpa | XP_002328161.1 | predicted protein [Populus trichocarpa] | 7.0e-21 | 73% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQV7
Fln msg: Distance to subject end: 27 aas, your sequence is shorter than subject: 78 - 598
Fln protein:
N
Protein Length:
79
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c104729___LYKKALLSPXXXXXXXXXXXXXXXXXKILSSSWEVGYNAMTDKYENLLSAGVIDPAKVSRCALQNAASVAGM
B8LQV7________________IVQKALVSPAALIANNAGVEGDVVVEKILTSDWEMGYNAMTDTYENLLNSGVIDPSKVARCALQNAASVAGM
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain