SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene141335

Length: 288 nt

UniGene Fasta

>sp_v3.0_unigene141335
TCAGTTGATGCATCTAATAAGGTAAAAGATGGCCACTTCTTGTTTCAGTGATTGGATCAGGTTGCTGAGGAGGTGGGGGTGGCTAATGTTGTTCAAGTCATCACAGATAATGCCTCTAACTATGTTCTTGCTAGTAAACTGTTAGAGGAAAAACACAAGACCATCTTTTGGACCCCATGTGCTGCACATTGCATAGACCTCATGCTTGAGGATATTGGAAATTAGATTGGGTCAAAACACTCTAGATCATGCCAAAGCATAACAAATTTATCTACAATCATTGATGGA

Ace file of the UniGene sp_v3.0_unigene141335

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	DUF659 domain containing protein	-	-	6.0e-31	72%
FL-Next	tr=Putative uncharacterized protein; Vitis vinifera (Grape).	-	-	0.0	65%

Source	Gene names
Sma3	B1096D03.3; B1150E06.26; GSVIVT00000858001; GSVIVT00001531001; GSVIVT00001874001; GSVIVT00002235001; GSVIVT00002367001; GSVIVT00003156001; GSVIVT00005726001; GSVIVT00006112001; GSVIVT00010563001; GSVIVT00012114001; GSVIVT00012683001; GSVIVT00013610001; GS

Source	GOs	Term	Type	Identity
Sma3	intracellular	GO:0005622	Cellular Component	-
Sma3	photosystem I	GO:0009522	Cellular Component	-
Sma3	thylakoid	GO:0009579	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	DNA binding	GO:0003677	Molecular Function	-
Sma3	RNA binding	GO:0003723	Molecular Function	-
Sma3	catalytic activity	GO:0003824	Molecular Function	-
Sma3	ubiquitin thiolesterase activity	GO:0004221	Molecular Function	-
Sma3	hydrolase activity, hydrolyzing O-glycosyl compounds	GO:0004553	Molecular Function	-
Sma3	zinc ion binding	GO:0008270	Molecular Function	-
Sma3	drug transmembrane transporter activity	GO:0015238	Molecular Function	-
Sma3	antiporter activity	GO:0015297	Molecular Function	-
Sma3	protein dimerization activity	GO:0046983	Molecular Function	-
Sma3	carbohydrate metabolic process	GO:0005975	Biological Process	-
Sma3	ubiquitin-dependent protein catabolic process	GO:0006511	Biological Process	-
Sma3	drug transmembrane transport	GO:0006855	Biological Process	-
Sma3	DNA integration	GO:0015074	Biological Process	-
Sma3	photosynthesis	GO:0015979	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Neuraxin/MAP1B repeat	IPR000102	-	-
Sma3	Zinc finger, FYVE-type	IPR000306	-	-
Sma3	Regulator of chromosome condensation, RCC1	IPR000408	-	-
Sma3	Photosystem I PsaA/PsaB	IPR001280	-	-
Sma3	Pumilio RNA-binding repeat	IPR001313	-	-
Sma3	Glycoside hydrolase, family 1	IPR001360	-	-
Sma3	Peptidase C12, ubiquitin carboxyl-terminal hydrolase 1	IPR001578	-	-
Sma3	Integrase, catalytic core	IPR001584	-	-
Sma3	Pleckstrin homology domain	IPR001849	-	-
Sma3	Zinc finger, CCHC-type	IPR001878	-	-
Sma3	Multi antimicrobial extrusion protein	IPR002528	-	-
Sma3	Argonaute/Dicer protein, PAZ	IPR003100	-	-
Sma3	Zinc finger, BED-type predicted	IPR003656	-	-
Sma3	Domain of unknown function DUF250	IPR004853	-	-
Sma3	Sugar transporter, conserved site	IPR005829	-	-
Sma3	Domain of unknown function DUF659	IPR007021	-	-
Sma3	Zinc finger, C2H2	IPR007087	-	-
Sma3	HAT dimerisation	IPR008906	-	-
Sma3	Regulator of chromosome condensation/beta-lactamase-inhibitor protein II	IPR009091	-	-
Sma3	Histidine triad motif	IPR011151	-	-
Sma3		IPR011523	-	-
Sma3	Armadillo-like helical	IPR011989	-	-
Sma3	Pleckstrin homology-like domain	IPR011993	-	-
Sma3	Reverse transcriptase, RNA-dependent DNA polymerase	IPR013103	-	-
Sma3	Brevis radix-like domain	IPR013591	-	-
Sma3	Glycoside hydrolase, subgroup, catalytic domain	IPR013781	-	-
Sma3		IPR015706	-	-
Sma3	Zinc finger, C2H2-like	IPR015880	-	-
Sma3	Zinc finger, FYVE-related	IPR017455	-	-
Sma3	ABC transporter, integral membrane type 1	IPR017940	-	-
Sma3	EF-Hand 1, calcium-binding site	IPR018247	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT1G36095.1	DNA binding chr1:13491370-13492725 REVERSE LENGTH=301	5.0e-20	59%
RefSeq	Arabidopsis thaliana	NP_174842.1	DNA binding protein [Arabidopsis thaliana]	6.0e-20	59%
RefSeq	Populus trichocarpa	XP_002329897.1	predicted protein, partial [Populus trichocarpa]	3.0e-21	57%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: tr_plants

Fln subject: A5BC22

Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 329 aas, your sequence is shorter than subject: 75 - 674

Fln protein: SVDASNKVKDGHFLFQ*LDQVAEEVGVANVVQVITDNASNYVLASKLLEEKHKTIFWTPCAAHCIDLMLEDIGN*

Protein Length: 76

Fln nts: TCAGTTGATGCATCTAATAAGGTAAAAGATGGCCACTTCTTGTTTCAGTGATTGGATCAGGTTGCTGAGGAGGTGGGGGTGGCTAATGTTGTTCAAGTCATCACAGATAATGCCTCTAACTATGTTCTTGCTAGTAAACTGTTAGAGGAAAAACACAAGACCATCTTTTGGACCCCATGTGCTGCACATTGCATAGACCTCATGCTTGAGGATATTGGAAATTAGATTGGGTCAAAACACTCTAGATCATGCCAAAGCATAACAAATTTATCTACAATCATTGATGGA

Fln Alignment:

AllPine_a_rep_c103773___SVDASNKVKDGHFLFQ*LDQVAEEVGVANVVQVITDNASNYVLASKLLEEKHKTIFWTPCAAHCIDLMLEDIG
A5BC22________________SIDASDTIKNGELMFKYLDEVVEEIGEENVVQVITDNASNYVNAGMRLMEKRSRLWWTPCAAHCIDLMLEDIG

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain