SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene140895

Length: 277 nt

UniGene Fasta

>sp_v3.0_unigene140895
CGTCGTGACCTTGGCTGTCACTCATTTCTATGACCAGTCACCTGATGCTATGCGCAGTTTATGTAGTGCACTTTCTCTTCTTACTACATGGTTGTCGAACTATTTGAGTAGCCTTATTGTTACAGTTGTAATGTATGCAACTACGAAAGGAGGGAATGTAGGATGGATACCTGATAATTTGAATGAAGGCCACCTGGATTACTACTTTTGGGTATTAGCCTCACTCAGCCTCTTGAATTTGCTTGTATATGTTTCTTGTGCCCATCGGTACAAGTAC

Ace file of the UniGene sp_v3.0_unigene140895

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Os03g0719900 protein n=3 Tax=Oryza sativa RepID=Q93VE2_ORYSJ	-	-	3.0e-24	62%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	92%
Sma3	POT family protein, expressed	-	-	2.885e-14	-

Source	Gene names
Sma3	At1g62200; At2g02020; At2g02040; At3g54140; At5g01180; B1026C12.10; B1065G12.20; B1065G12.21; B1377B10.10; F14H20.11; F19K23.13; F24B22.100; F7J8_160; GSVIVT00021471001; GSVIVT00024159001; GSVIVT00030681001; LOC_Os03g13240; LOC_Os03g13250; LOC_Os03g13274;

Source	GOs	Term	Type	Identity
Sma3	plant-type vacuole	GO:0000325	Cellular Component	-
Sma3	vacuolar membrane	GO:0005774	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	nucleic acid binding	GO:0003676	Molecular Function	-
Sma3	transporter activity	GO:0005215	Molecular Function	-
Sma3	high affinity oligopeptide transporter activity	GO:0015334	Molecular Function	-
Sma3	dipeptide transporter activity	GO:0042936	Molecular Function	-
Sma3	tripeptide transporter activity	GO:0042937	Molecular Function	-
Sma3	oligopeptide transport	GO:0006857	Biological Process	-
Sma3	protein transport	GO:0015031	Biological Process	-
Sma3	dipeptide transport	GO:0042938	Biological Process	-
Sma3	tripeptide transport	GO:0042939	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Oligopeptide transporter	IPR000109	-	-
Sma3	Aldehyde dehydrogenase, conserved site	IPR016160	-	-
Sma3	PTR2 family proton/oligopeptide symporter, conserved site	IPR018456	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G02040.1	ATPTR2-B, NTR1, PTR2-B, PTR2, ATPTR2 peptide transporter 2 chr2:487542-489707 FORWARD LENGTH=585	4.0e-27	71%
RefSeq	Arabidopsis thaliana	NP_178313.1	peptide transporter PTR2 [Arabidopsis thaliana]	6.0e-27	71%
RefSeq	Populus trichocarpa	XP_002315835.1	predicted protein [Populus trichocarpa]	3.0e-30	73%

Full-Lengther Next Prediction

Fln status: Putative C-terminus

Fln database: coniferopsida.fasta

Fln subject: A9NVR2

Fln msg: STOP codon was not found. Distance to subject end: 4 aas, your sequence is shorter than subject: 92 - 594

Fln protein: VVTLAVTHFYDQSPDAMRSLCSALSLLTTWLSNYLSSLIVTVVMYATTKGGNVGWIPDNLNEGHLDYYFWVLASLSLLNLLVYVSCAHRYKY

Protein Length: 93

Fln nts: CGTCGTGACCTTGGCTGTCACTCATTTCTATGACCAGTCACCTGATGCTATGCGCAGTTTATGTAGTGCACTTTCTCTTCTTACTACATGGTTGTCGAACTATTTGAGTAGCCTTATTGTTACAGTTGTAATGTATGCAACTACGAAAGGAGGGAATGTAGGATGGATACCTGATAATTTGAATGAAGGCCACCTGGATTACTACTTTTGGGTATTAGCCTCACTCAGCCTCTTGAATTTGCTTGTATATGTTTCTTGTGCCCATCGGTACAAGTAC

Fln Alignment:

AllPine_a_rep_c102508___FYDQSPDAMRSLCSALSLLTTWLSNYLSSLIVTVVMYATTKGGNVGWIPDNLNEGHLDYYFWXXXXXXXXXXXXXXXCAHRYKY
A9NVR2________________FYDQSPDAMRSLCSALSLLTTALGNYLSSLIVTIVMFATTKGGNIGWIPDNLNEGHLDYYFWVLASLSVLNLLVYVSCAHRYKY

SNPs (tot: 16)

Position	A %	C %	G %	T %	Probability
80		66	33		0.997452
81		33	33	33	0.997747
83	66	33			0.997467
84		66	33		0.997467
86		33	33		0.997753
88	33	66			0.997452
90			33	66	0.997476
92	33	33	33		0.997752
94		33		66	0.997476
96		33	66		0.997456
97		33	33	33	0.99775
98		66	33		0.997454
99	33	33	33		0.997751
100	66	33			0.997476
101	66			33	0.997476
103	33		33	33	0.997753

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain