SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene140676

Length: 458 nt

UniGene Fasta

>sp_v3.0_unigene140676
AATGTGTCAAGATTCTCAATCTACAAAATGAAGGGGCGTCAAAAGAGTTTTGATAGAGAGTGCAAAGTTTTGAGTAAAGTTAGACACCGAAATTTGATTCGGGTCATAACCTGTTATTCAGATCTCCAAATCAAAGCTTTGATATTTCCATTAATGCCAAATGGAAGCCTAGAAAAGTGGTTATATCCCGATGATGTAGAACAAAGTAGTTTGAATCTGATTCAAAGGTTGAATATAGCAATAGACATCGCCCAAGGCATGGCGTATCTCCATCACCATTGTTTTGTGCAAGTGATTCATTGTGATTTGAAACCCAACAATGTGTTGTTGGGTGAAGATATGACTGCATATTTAATAGACTTTGGCATTGCTACTATATGTTTTGCAAGTAATGAAGATGGGTCTCTCACTTCCACAAATGCACTCAAGGGATCTACAGGGTACATTCCTCCAGGTAT

Ace file of the UniGene sp_v3.0_unigene140676

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Kinase-like protein (Fragment) n=1 Tax=Prunus avium RepID=A8BLB8_PRUAV	-	-	3.0e-36	50%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	38%
Sma3	Kinase-like protein	-	-	7.348e-12	-

Source	ECs	Term	Type	e value	Identity
Sma3	2-alkenal reductase.	EC:1.3.1.74	-	4.499e-12	-

Source	Gene names
Sma3	At2g24130; B1047H05.12; B1047H05.14; B1047H05.16; B1047H05.26; B1047H05.29; B1047H05.53; GSVIVT00003509001; GSVIVT00004217001; GSVIVT00005204001; GSVIVT00014285001; GSVIVT00014914001; GSVIVT00017170001; GSVIVT00018756001; GSVIVT00018759001; GSVIVT00018765

Source	GOs	Term	Type	Identity
Sma3	proton-transporting V-type ATPase, V0 domain	GO:0033179	Cellular Component	-
Sma3	protein kinase activity	GO:0004672	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	receptor activity	GO:0004872	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	electron carrier activity	GO:0009055	Molecular Function	-
Sma3	hydrogen ion transmembrane transporter activity	GO:0015078	Molecular Function	-
Sma3	oxidoreductase activity	GO:0016491	Molecular Function	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	ATP synthesis coupled proton transport	GO:0015986	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	C2 calcium-dependent membrane targeting	IPR000008	-	-
Sma3	Protease inhibitor I4, serpin	IPR000215	-	-
Sma3	ATPase, V0 complex, proteolipid subunit C	IPR000245	-	-
Sma3	Fumarate lyase	IPR000362	-	-
Sma3	ATPase, F0 complex, subunit A	IPR000568	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Leucine-rich repeat	IPR001611	-	-
Sma3	Kinesin, motor domain	IPR001752	-	-
Sma3	Serine/threonine- / dual-specificity protein kinase, catalytic domain	IPR002290	-	-
Sma3	FAD-binding, type 1	IPR003097	-	-
Sma3	Leucine-rich repeat, typical subtype	IPR003591	-	-
Sma3	Phosphopantetheine attachment site	IPR006162	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Copine	IPR010734	-	-
Sma3	ATPase, V0 complex, proteolipid subunit C, eukaryotic	IPR011555	-	-
Sma3	Leucine-rich repeat-containing N-terminal, type 2	IPR013210	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	ABC transporter, conserved site	IPR017871	-	-
Sma3	Cytochrome P450, conserved site	IPR017972	-	-
Sma3	C2 membrane targeting protein	IPR018029	-	-
Sma3	Glycoside hydrolase, family 1, active site	IPR018120	-	-
Sma3	EF-Hand 1, calcium-binding site	IPR018247	-	-
Sma3	WD40 repeat, conserved site	IPR019775	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT2G24130.1	Leucine-rich receptor-like protein kinase family protein chr2:10258148-10261220 FORWARD LENGTH=980	1.0e-39	50%
RefSeq	Arabidopsis thaliana	NP_179990.1	putative leucine-rich repeat transmembrane protein kinase [Arabidopsis thaliana]	1.0e-39	50%
RefSeq	Populus trichocarpa	XP_002337529.1	predicted protein, partial [Populus trichocarpa]	5.99756e-43	49%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: B8LPH3

Fln msg: Distance to subject end: 113 aas, your sequence is shorter than subject: 152 - 360

Fln protein: NVSRFSIYKMKGRQKSFDRECKVLSKVRHRNLIRVITCYSDLQIKALIFPLMPNGSLEKWLYPDDVEQSSLNLIQRLNIAIDIAQGMAYLHHHCFVQVIHCDLKPNNVLLGEDMTAYLIDFGIATICFASNEDGSLTSTNALKGSTGYIPPG

Protein Length: 153

Fln nts: AATGTGTCAAGATTCTCAATCTACAAAATGAAGGGGCGTCAAAAGAGTTTTGATAGAGAGTGCAAAGTTTTGAGTAAAGTTAGACACCGAAATTTGATTCGGGTCATAACCTGTTATTCAGATCTCCAAATCAAAGCTTTGATATTTCCATTAATGCCAAATGGAAGCCTAGAAAAGTGGTTATATCCCGATGATGTAGAACAAAGTAGTTTGAATCTGATTCAAAGGTTGAATATAGCAATAGACATCGCCCAAGGCATGGCGTATCTCCATCACCATTGTTTTGTGCAAGTGATTCATTGTGATTTGAAACCCAACAATGTGTTGTTGGGTGAAGATATGACTGCATATTTAATAGACTTTGGCATTGCTACTATATGTTTTGCAAGTAATGAAGATGGGTCTCTCACTTCCACAAATGCACTCAAGGGATCTACAGGGTACATTCCTCCAGGTAT

Fln Alignment:

AllPine_a_rep_c101706___RQKSFDRECKVLSKVRHRNLIRVITCYSDLQIKALIFPLMPNGSLEKWLYPDDVEQSSLNLIQRLNIAIDIAQGMAYLHHHCFVQVIHCDLKPNNVLLGEDMTAYLIDFGIATICFASNEDGSLTSTNALKGSTGYIPP
B8LPH3________________QQRGFERELDAMGDIKHRNVVTLRGYYSSSHVNLLVYDLMQNGSLDGILHSRSPNKVSLDWAARNKIALGSARGIAYLHHDCIPHIIHRDIKSSNILLDEEMEARISDFGLATLI---NPDQTHVST-IVAGTFGYLAP

SNPs (tot: 8)

Position	A %	C %	G %	T %	Probability
145	16			83	0.994512
146	16			83	0.994512
148		83	16		0.994512
149		85		14	0.993533
159	85	14			0.993533
197			42	57	1.0
219			85	14	0.993533
265		83		16	0.994512

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain