SustainPineDB

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene140558

Length: 1391 nt

UniGene Fasta

Ace file of the UniGene sp_v3.0_unigene140558

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Autoinhibited calcium ATPase n=2 Tax=Populus trichocarpa RepID=B9HK60_POPTR	-	-	0.0	59%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	50%
Sma3	Autoinhibited calcium ATPase	-	-	1.158e-24	-

Source	ECs	Term	Type	e value	Identity
Sma3	Calcium-transporting ATPase.	EC:3.6.3.8	-	0.0	-

Source	Gene names
Sma3	ACA10; ACA12; ACA13; ACA2; ACA3; ACA5; ACA7; ACA8; ACA9; AT5G57110; ATPse2-2B; A_TM018A10.4; At1g07670; At1g07810; At1g27770; At2g22950; At2g41560; At3g21180; At3g22910; At3g63380; At3g63380/MAA21_10; At4g00900; At4g29900; At4g37640; At5g57110; CA2; CA6;

Source	GOs	Term	Type	Identity
Sma3	endoplasmic reticulum membrane	GO:0005789	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	integral to membrane	GO:0016021	Cellular Component	-
Sma3	integral to endoplasmic reticulum membrane	GO:0030176	Cellular Component	-
Sma3	magnesium ion binding	GO:0000287	Molecular Function	-
Sma3	calcium-transporting ATPase activity	GO:0005388	Molecular Function	-
Sma3	calcium ion binding	GO:0005509	Molecular Function	-
Sma3	calmodulin binding	GO:0005516	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	monovalent inorganic cation transmembrane transporter activity	GO:0015077	Molecular Function	-
Sma3	ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism	GO:0015662	Molecular Function	-
Sma3	protein self-association	GO:0043621	Molecular Function	-
Sma3	ATP biosynthetic process	GO:0006754	Biological Process	-
Sma3	cation transport	GO:0006812	Biological Process	-
Sma3	calcium ion transport	GO:0006816	Biological Process	-
Sma3	single fertilization	GO:0007338	Biological Process	-
Sma3	pollen development	GO:0009555	Biological Process	-
Sma3	response to nematode	GO:0009624	Biological Process	-
Sma3	monovalent inorganic cation transport	GO:0015672	Biological Process	-
Sma3	inflorescence morphogenesis	GO:0048281	Biological Process	-
Sma3	shoot development	GO:0048367	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain	IPR000194	-	-
Sma3	ATPase, P-type, H+ transporting proton pump	IPR000695	-	-
Sma3	ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter	IPR001757	-	-
Sma3	ATPase, P-type cation-transporter, N-terminal	IPR004014	-	-
Sma3	ATPase, P-type cation exchange, alpha subunit, eukaryotic	IPR005775	-	-
Sma3	ATPase, P-type, calcium-transporting	IPR005782	-	-
Sma3	Haloacid dehalogenase-like hydrolase	IPR005834	-	-
Sma3	ATPase, P-type cation-transporter, C-terminal	IPR006068	-	-
Sma3	ATPase, P-type cation exchange, alpha subunit	IPR006069	-	-
Sma3	ATPase, P-type, calcium-transporting, PMCA-type	IPR006408	-	-
Sma3	Inorganic pyrophosphatase	IPR008162	-	-
Sma3	ATPase, P-type, ATPase-associated domain	IPR008250	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3	ATPase, P-type phosphorylation site	IPR018303	-	-

Source	Species	ID	Description	Identity
ATG	Arabidoptis thaliana	AT5G57110.1	ACA8, AT-ACA8 autoinhibited Ca2+ -ATPase, isoform 8 chr5:23109729-23116857 REVERSE LENGTH=1074	51%
RefSeq	Arabidopsis thaliana	NP_851200.1	calcium-transporting ATPase 8 [Arabidopsis thaliana]	51%
RefSeq	Populus trichocarpa	XP_002315383.1	autoinhibited calcium ATPase [Populus trichocarpa]	61%

Full-Lengther Next Prediction

Fln status: N-terminus

Fln database: coniferopsida.fasta

Fln subject: D5AEG4

Fln msg: Overlapping hits, possible frame ERROR between 1201 and 823, Unexpected STOP codon at 3' end. Distance to subject end: 131 aas,

Fln protein: MAQNTTGSVFKPEGGGEIEVTGSPTEKAILSWALKLGMNFHQERSKSSVLHVSTFNSEKKRGGVVLKKSETEAHIHWKGAAEIILDLCNTWIDHAGLVREMTPDKADGFKKSIEDMAADRLRCIAFAYRVYDLYNVPADEVQRQSWNIPEENLTLLAIVGMKDPCRPNVSDAIRSCQRAGVKVRMVTGDNIYTATAIALECGILQKEQPTVEPTIIEGRVFRNYSEEEREKIVDQIYVMGRSSPTDKLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEHLMHRPSVKRR*

Protein Length: 390

Fln nts: ATGGGACAGGATCAGGGAACTACCAGACAGTTCAGAAAATCTCCCTTCTATTGTACTTTCCCTTCTTATTGAGGGT_-_ATGGCGCAGAACACCACAGGGAGCGTCTTTAAACCTGAGGGTGGTGGAGAGATAGAAGTGACAGGATCTCCAACGGAGAAGGCTATTCTTTCTTGGGCATTGAAACTTGGAATGAATTTTCATCAAGAAAGATCCAAATCCTCCGTCTTACATGTTTCTACTTTCAACTCGGAAAAGAAACGTGGCGGTGTTGTTCTGAAGAAGTCTGAAACTGAAGCACATATCCATTGGAAAGGAGCTGCAGAGATCATACTAGACCTCTGCAATACCTGGATTGACCATGCTGGTTTAGTACGAGAAATGACTCCGGATAAGGCAGATGGGTTTAAGAAAAGCATCGAAGACATGGCCGCAGATCGATTACGGTGCATTGCTTTTGCTTACAGAGTATACGATCTTTATAATGTGCCTGCTGATGAAGTGCAACGCCAATCATGGAATATTCCTGAAGAAAACCTTACCCTCTTGGCAATTGTTGGGATGAAGGATCCATGCAGACCTAATGTAAGTGATGCTATCCGGTCGTGTCAACGTGCTGGTGTTAAGGTACGAATGGTGACGGGTGATAACATTTACACGGCAACAGCTATAGCTCTTGAATGTGGCATACTCCAGAAAGAACAGCCTACAGTAGAGCCAACTATAATTGAAGGACGGGTTTTTCGCAACTACAGCGAAGAAGAGAGAGAGAAAATTGTGGACCAAATTTATGTAATGGGAAGATCCTCACCTACGGACAAACTTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGAGCACCTCATGCATCGGCCTTCAGTAAAGCGCAGGTAGGACATTGTTATCAAGGAAAATTCCTCCGTTGGATTAATAGCTATATAGTTCTTGCAGAATCAAAGAACATTTGAAATAAAGAGTATGGGACTTACAGTGAATAAATATATGCATGTGCCAAACCTACATTATTATCAATTGATATTAAA

Fln Alignment:

AllPine_a_rep_c101072___MVTGDNIYTATAIALECGILQKEQPTVEPTIIEGRVFRNYSEEEREKIVDQIYVMGRSSPTDKLYLVQALRK*xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx-STCIGN*IPNEHLMHRPSVKRR
D5AEG4________________MVTGDNIYTAKAIALECGILQREDTIEKYAIIEGREFRNFSEEERLEIVDKICVMGRSSPTDKLFLVQALRKKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxGALALATEAPTDHLMNRPPVGRR

SNPs (tot: 5)

Position	A %	C %	G %	T %	Probability
469		66		33	1.0
474	16			83	0.994512
500		80	20		0.995493
510		80		20	0.995493
620	75	25			0.996473

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain