|
||||||
|
UniGene Name: sp_v3.0_unigene139111
Length: 244 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene139111
C |
|
Ace file of the UniGene sp_v3.0_unigene139111
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Ubiquitin carrier protein n=1 Tax=Picea sitchensis RepID=A9NTD0_PICSI | - | - | 8.0e-19 | 87% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 87% |
| Sma3 | Ubiquitin carrier protein | - | - | 1.029e-11 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ligases, Forming carbon-nitrogen bonds, Acid--D-amino-acid ligases (peptide synthases). | EC:6.3.2.- | - | 4.522e-11 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Tryptophan metabolism | 00380 | 4.522e-11 | % | |
| Sma3 | Biosynthesis of siderophore group nonribosomal peptides | 01053 | 4.522e-11 | % | |
| Sma3 | Ubiquitin--protein ligase. | EC:6.3.2.19 | - | 5.895e-06 | - |
| Source | Gene names |
|---|---|
| Sma3 | At5g25760; CHLREDRAFT_131472; F18A17.10; GSVIVT00032457001; OJ1626_B09.3; OJ1643_A10.34; Os02g0634800; PEX4; PHYPADRAFT_167880; POPTRDRAFT_716764; POPTRDRAFT_835782; RCOM_0287850; UBC; UBC21; ubc2; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | ubiquitin-protein ligase activity | GO:0004842 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | small conjugating protein ligase activity | GO:0019787 | Molecular Function | 0.0 | - |
| Sma3 | fatty acid beta-oxidation | GO:0006635 | Biological Process | 0.0 | - |
| Sma3 | protein import into peroxisome matrix | GO:0016558 | Biological Process | 0.0 | - |
| Sma3 | modification-dependent protein catabolic process | GO:0019941 | Biological Process | 0.0 | - |
| Sma3 | post-translational protein modification | GO:0043687 | Biological Process | 0.0 | - |
| Sma3 | regulation of protein metabolic process | GO:0051246 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ubiquitin-conjugating enzyme, E2 | IPR000608 | - | 0.0 | - |
| Sma3 | Ubiquitin-conjugating enzyme/RWD-like | IPR016135 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G25760.1 | PEX4, UBC21 peroxin4 chr5:8967983-8969173 FORWARD LENGTH=157 | 6.0e-19 | 78% |
| RefSeq | Arabidopsis thaliana | NP_001031939.1 | putative ubiquitin-conjugating enzyme E2 21 [Arabidopsis thaliana] | 7.0e-19 | 78% |
| RefSeq | Populus trichocarpa | XP_002324810.1 | predicted protein [Populus trichocarpa] | 5.0e-21 | 77% |
| Full-Lengther Next Prediction |
|---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NTD0
Fln msg: your sequence is shorter than subject: 67 - 160
Fln protein:
R
Protein Length:
68
Fln nts:
C
Fln Alignment:
AllPine_a_rep_c98054___TLQSVCRAIIALMARRDLAVPLNCDCGNLLRSGDDRGYQSMARMYTRLAATANR
A9NTD0________________TLQSVCRAIIALMAHPEPDSPLNCDCGNLLRSGDDRGYQSMARMYTRLAATANK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
