UniGene Name: sp_v3.0_unigene138740
Length: 235 nt
![]() |
---|
>sp_v3.0_unigene138740
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative ribosomal protein S5 [Oryza sativa Japonica Group] | - | - | 3.0e-20 | 94% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 72% |
Sma3 | Ribosomal protein S5 containing protein, expressed | - | - | 9.077e-09 | - |
Source | Gene names |
---|---|
Sma3 | At2g33800; GSVIVT00003076001; LOC_Os03g34040; MICPUCDRAFT_48160; MICPUN_92603; OSJNBa0037J17.7; OSJNBb0047D08.4; Os03g0452300; OsI_12226; OsJ_11420; PHYPADRAFT_111761; PHYPADRAFT_123576; PHYPADRAFT_126803; POPTRDRAFT_1075454; RCOM_1674110; T1B8.10; rps5; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | chloroplast thylakoid membrane | GO:0009535 | Cellular Component | 0.0 | - |
Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
Sma3 | cyanelle | GO:0009842 | Cellular Component | 0.0 | - |
Sma3 | small ribosomal subunit | GO:0015935 | Cellular Component | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | rRNA binding | GO:0019843 | Molecular Function | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
Sma3 | response to antibiotic | GO:0046677 | Biological Process | 0.0 | - |
Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Ribosomal protein S5 | IPR000851 | - | 0.0 | - |
Sma3 | Ribosomal protein S5, C-terminal | IPR005324 | - | 0.0 | - |
Sma3 | Ribosomal protein S5, bacterial-type | IPR005712 | - | 0.0 | - |
Sma3 | Ribosomal protein S5, N-terminal | IPR013810 | - | 0.0 | - |
Sma3 | Double-stranded RNA-binding-like | IPR014720 | - | 0.0 | - |
Sma3 | Ribosomal protein S5 domain 2-type fold, subgroup | IPR014721 | - | 0.0 | - |
Sma3 | Ribosomal protein S5, N-terminal, conserved site | IPR018192 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G33800.1 | Ribosomal protein S5 family protein chr2:14300925-14302352 REVERSE LENGTH=303 | 7.0e-21 | 80% |
RefSeq | Arabidopsis thaliana | NP_180936.1 | 30S ribosomal protein S5 [Arabidopsis thaliana] | 1.0e-20 | 80% |
RefSeq | Populus trichocarpa | XP_002305129.1 | predicted protein [Populus trichocarpa] | 1.0e-22 | 86% |
![]() |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NV88
Fln msg: your sequence is shorter than subject: 68 - 328
Fln protein:
V
Protein Length:
69
Fln nts:
C
Fln Alignment:
AllPine_a_rep_c97561___EMAGVENALGKQLRSKNPLNNARATVKATQMMRQFSDVAAERGLPMEELWK
A9NV88________________ELAGVENALGKQLGSDNPLNNARAVIDAVSQMRQFREVAEYRGIPMEELWK
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain