UniGene Name: sp_v3.0_unigene138454
Length: 188 nt
UniGene Fasta |
---|
>sp_v3.0_unigene138454
G |
Ace file of the UniGene sp_v3.0_unigene138454 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Pentatricopeptide repeat protein (Fragment) n=1 Tax=Picea abies RepID=B3U1V1_PICAB | - | - | 1.0e-23 | 85% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 74% |
Sma3 | Pentatricopeptide repeat protein | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | At1g20230; At2g22070; At3g03580; At3g12770; At3g57430; At4g33170; At4g33990; EMB2758; F17I5.180; F4I10.100; GSVIVT00000307001; GSVIVT00000887001; GSVIVT00002188001; GSVIVT00005426001; GSVIVT00006467001; GSVIVT00006516001; GSVIVT00006945001; GSVIVT00010543 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Sma3 | thiamine biosynthetic process | GO:0009228 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase S8/S53, subtilisin/kexin/sedolisin | IPR000209 | - | 0.0 | - |
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Adenosine/AMP deaminase domain | IPR001365 | - | 0.0 | - |
Sma3 | C-5 cytosine methyltransferase | IPR001525 | - | 0.0 | - |
Sma3 | Thiamine biosynthesis protein ThiC | IPR002817 | - | 0.0 | - |
Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
Sma3 | Immunoglobulin/major histocompatibility complex, conserved site | IPR003006 | - | 0.0 | - |
Sma3 | MAP kinase, conserved site | IPR003527 | - | 0.0 | - |
Sma3 | Serine/threonine-protein kinase, active site | IPR008271 | - | 0.0 | - |
Sma3 | Tetratricopeptide-like helical | IPR011990 | - | 0.0 | - |
Sma3 | Methyltransferase type 11 | IPR013216 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | IPR017442 | - | 0.0 | - | |
Sma3 | Asp/Glu racemase, active site | IPR018187 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G33170.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr4:15995701-15998673 REVERSE LENGTH=990 | 4.0e-23 | 68% |
RefSeq | Arabidopsis thaliana | NP_195043.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 5.0e-23 | 68% |
RefSeq | Populus trichocarpa | XP_002299387.1 | predicted protein [Populus trichocarpa] | 3.0e-24 | 70% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9P0W0
Fln msg: Distance to subject end: 22 aas, your sequence is shorter than subject: 62 - 370
Fln protein:
V
Protein Length:
63
Fln nts:
G
Fln Alignment:
AllPine_a_rep_c97167___VLNDVEEEQMENILCYHSEKLAIAFGLLNTPTGTPIRIIKNLRACGDCHSATKFISKIVGRE
A9P0W0________________VLHDVEEEQKEWILGHHSEKLAIAFGIISTPPGTTIRVVKNLRVCGDCHTATKFISRIVSRE
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain