SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene138297

Length: 510 nt

This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense

UniGene Fasta (sense)

>sp_v3.0_unigene138297
GAACCAGGCCGGTACTTGGGTGTTAGGAGAGGCCATGGGGTCGTTACGCTGCAGAGATTCGAGACCCAACTACCAAAGAAAGACATTGGCTCGGCACCTTCGATACAGCCGAAGAAGCAGCCTTGGCTTATGACAGAGCTGCACGATCAATGCGAGGGTTTAAGGCCAGAACCAATTTCATGTACGCTGATATGCCCCAGGGTGCCTCCCTGACTAATGACATGTCTCCAGAAGAGATTGAGAGGCTGAGGAGCTTGTTGCTGGCTTCTCGGATGAACTGGACAGATCATCAACAACAACAAGGCCAACCAGAGCAAGTTTGCTATAATATCGAAGAGAATTCAAGGGTTTTGCATGATTCATCTTGCTCCATTCCCTTCAATATCGGGTCTCTAAACCCATCTCAATTCATGTCCGTGCCTTGCAATATCTCAGAGCAAAGCAAGGCTGCAATGAATCCCAATTTTGAAGCAGAGAATGCTCTTCTCATGCAGTCTGATAGTGCATGGA

Ace file of the UniGene sp_v3.0_unigene138297 (antisense)

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	DNA binding protein, putative n=1 Tax=Ricinus communis RepID=B9RG14_RICCO	-	-	5.0e-22	50%
FL-Next	tr=Ethylene-responsive element binding factor-like protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	62%
Sma3	AP2/ERF domain-containing transcription factor	-	-	1.4013e-45	-

Source	Gene names
Sma3	AT1G53910; ATF2; At1g03800; At1g12890; At1g12980; At1g24590; At1g28160; At1g28360; At1g28370; At1g50640; At1g53170; At1g53910; At1g80580; At2g33710; At2g46310; At3g15210; At3g61630; At4g11140; At5g13330; At5g13910; At5g18560; At5g44210; B0811B10.20; B1045

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	nucleolus	GO:0005730	Cellular Component	-
Sma3	cytoplasm	GO:0005737	Cellular Component	-
Sma3	plastid	GO:0009536	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	nuclear body	GO:0016604	Cellular Component	-
Sma3	sequence-specific DNA binding transcription factor activity	GO:0003700	Molecular Function	-
Sma3	phosphatidylinositol phospholipase C activity	GO:0004435	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	transcription repressor activity	GO:0016564	Molecular Function	-
Sma3	hydrolase activity	GO:0016787	Molecular Function	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	lipid metabolic process	GO:0006629	Biological Process	-
Sma3	defense response	GO:0006952	Biological Process	-
Sma3		GO:0007242	Biological Process	-
Sma3	response to auxin stimulus	GO:0009733	Biological Process	-
Sma3	auxin mediated signaling pathway	GO:0009734	Biological Process	-
Sma3	cytokinin mediated signaling pathway	GO:0009736	Biological Process	-
Sma3	response to abscisic acid stimulus	GO:0009737	Biological Process	-
Sma3	gibberellic acid mediated signaling pathway	GO:0009740	Biological Process	-
Sma3	induced systemic resistance, jasmonic acid mediated signaling pathway	GO:0009864	Biological Process	-
Sma3	ethylene mediated signaling pathway	GO:0009873	Biological Process	-
Sma3	embryonic pattern specification	GO:0009880	Biological Process	-
Sma3	flower development	GO:0009908	Biological Process	-
Sma3	positive regulation of seed germination	GO:0010030	Biological Process	-
Sma3	specification of organ axis polarity	GO:0010084	Biological Process	-
Sma3	lateral root morphogenesis	GO:0010102	Biological Process	-
Sma3	negative regulation of ethylene mediated signaling pathway	GO:0010105	Biological Process	-
Sma3	response to chitin	GO:0010200	Biological Process	-
Sma3	transcription factor import into nucleus	GO:0042991	Biological Process	-
Sma3	leaf development	GO:0048366	Biological Process	-
Sma3	cotyledon development	GO:0048825	Biological Process	-
Sma3	regulation of cell cycle	GO:0051726	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	NUDIX hydrolase domain	IPR000086	-	-
Sma3	AP2/ERF domain	IPR001471	-	-
Sma3	Phospholipase C, phosphatidylinositol-specific, Y domain	IPR001711	-	-
Sma3	Sugar transporter, conserved site	IPR005829	-	-
Sma3	DNA ligase, ATP-dependent, conserved site	IPR016059	-	-
Sma3	Chaperonin Cpn60, conserved site	IPR018370	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT5G13910.1	LEP Integrase-type DNA-binding superfamily protein chr5:4482450-4483085 REVERSE LENGTH=211	7.0e-25	78%
RefSeq	Arabidopsis thaliana	NP_196895.1	ethylene-responsive transcription factor LEP [Arabidopsis thaliana]	9.0e-25	78%
RefSeq	Populus trichocarpa	XP_002297886.1	AP2/ERF domain-containing transcription factor [Populus trichocarpa]	6.0e-26	56%

Full-Lengther Next Prediction

Fln status: Putative C-terminus

Fln database: coniferopsida.fasta

Fln subject: E0ZH20

Fln msg: STOP codon was not found. Distance to subject end: 14 aas, your sequence is shorter than subject: 169 - 211

Fln protein: TRPVLGC*ERPWGRYAAEIRDPTTKERHWLGTFDTAEEAALAYDRAARSMRGFKARTNFMYADMPQGASLTNDMSPEEIERLRSLLLASRMNWTDHQQQQGQPEQVCYNIEENSRVLHDSSCSIPFNIGSLNPSQFMSVPCNISEQSKAAMNPNFEAENALLMQSDSAW

Protein Length: 170

Fln nts: GAACCAGGCCGGTACTTGGGTGTTAGGAGAGGCCATGGGGTCGTTACGCTGCAGAGATTCGAGACCCAACTACCAAAGAAAGACATTGGCTCGGCACCTTCGATACAGCCGAAGAAGCAGCCTTGGCTTATGACAGAGCTGCACGATCAATGCGAGGGTTTAAGGCCAGAACCAATTTCATGTACGCTGATATGCCCCAGGGTGCCTCCCTGACTAATGACATGTCTCCAGAAGAGATTGAGAGGCTGAGGAGCTTGTTGCTGGCTTCTCGGATGAACTGGACAGATCATCAACAACAACAAGGCCAACCAGAGCAAGTTTGCTATAATATCGAAGAGAATTCAAGGGTTTTGCATGATTCATCTTGCTCCATTCCCTTCAATATCGGGTCTCTAAACCCATCTCAATTCATGTCCGTGCCTTGCAATATCTCAGAGCAAAGCAAGGCTGCAATGAATCCCAATTTTGAAGCAGAGAATGCTCTTCTCATGCAGTCTGATAGTGCATGGA

Fln Alignment:

AllPine_a_rep_c96907___GC*ERPWGRYAAEIRDPTTKERHWLGTFDTXXXXXXXXXXXXRSMRGFKARTNFMYADMPQGASLTNDMS
E0ZH20________________GVRKRPWGRFAAEIRDPWKKTRLWLGTFDTAEEAARAYDNAARNLRGPKAKTNFAFHD-DTAALFSNDVT

SSRs (tot: 1)

Start position	End position	Sequence	Length
209	220	TTG TTG TTG TTG	12

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain