|
||||||
|
UniGene Name: sp_v3.0_unigene138219
Length: 186 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene138219
C |
|
Ace file of the UniGene sp_v3.0_unigene138219 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | cysteine-rich receptor-like protein kinase 36 [Arabidopsis thaliana] sp|Q9XEC6.1|CRK36_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase 36; Short=Cysteine-rich RLK36; Flags: Precursor gb|AAD29761.1|AF076243_8 putative receptor-like protein k | - | - | 2.0e-13 | 68% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 83% |
| Sma3 | Chromosome undetermined scaffold_302, whole genome shotgun sequence | - | - | 1.16e-11 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Transferases, Transferring phosphorous-containing groups, Protein-serine/threonine kinases. | EC:2.7.11.- | - | 1.474e-16 | - |
| Source | Gene names |
|---|---|
| Sma3 | AT4g21390; At4g04490; At4g04500; At4g04510; At4g04540; At4g04570; At4g11490; At4g21230; At4g21390; At4g21400; At4g21410; B0808H03.3; B1070A12.4; B120; CRK27; CRK28; CRK29; CRK33; CRK36; CRK37; CRK38; CRK39; CRK40; F18E5.10; F18E5.20; F25E4.110; F4H6.4; F4 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G04490.1 | CRK36 cysteine-rich RLK (RECEPTOR-like protein kinase) 36 chr4:2231957-2234638 REVERSE LENGTH=658 | 4.0e-18 | 68% |
| RefSeq | Arabidopsis thaliana | NP_192358.1 | cysteine-rich receptor-like protein kinase 36 [Arabidopsis thaliana] | 6.0e-18 | 68% |
| RefSeq | Populus trichocarpa | XP_002316620.1 | predicted protein, partial [Populus trichocarpa] | 4.0e-20 | 70% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LLJ5
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 36 aas, your sequence is shorter than subject: 61 - 505
Fln protein:
*
Protein Length:
62
Fln nts:
C
Fln Alignment:
AllPine_a_rep_c96772___NSSLDKFLFDATKRHLLDWKERYEIIVGTARGLAYLHEESQIRVIHRTLKTSNI
B8LLJ5________________NSSLDKIIFDITKRHLLDWRERYEIIVGTARGLAYLHEESEIRIIHRDIKASNI
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
