UniGene Name: sp_v3.0_unigene138123
Length: 230 nt
![]() |
---|
>sp_v3.0_unigene138123
G |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] sp|Q9M2Y7.1|PP274_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g49710 emb|CAB66909.1| putative protein [Arabidopsis thaliana] gb|AEE78579.1| pentatricopeptide repeat- | - | - | 3.0e-20 | 59% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 70% |
Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 1.811e-11 | - |
Source | Gene names |
---|---|
Sma3 | At1g74400; At2g01510; At2g22070; At2g36730; At3g11460; At3g16610; At3g49170; At3g49710; At4g13650; At4g30700; At4g38010; At5g09950; At5g19020; At5g40410; At5g43790; At5g56310; B1032F05.19; B1080A02.28; B1130E07.12; B1358B12.23; DYW9; EMB2261; F13K3.13; F1 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | mitosis | GO:0007067 | Biological Process | 0.0 | - |
Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
Sma3 | methylation | GO:0032259 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G19020.1 | MEF18 mitochondrial editing factor 18 chr5:6352771-6354828 REVERSE LENGTH=685 | 8.0e-26 | 57% |
RefSeq | Arabidopsis thaliana | NP_197403.2 | mitochondrial editing factor 18 [Arabidopsis thaliana] | 1.0e-25 | 57% |
RefSeq | Populus trichocarpa | XP_002309579.1 | predicted protein [Populus trichocarpa] | 3.0e-27 | 57% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AB53
Fln msg: Distance to subject end: 30 aas, your sequence is shorter than subject: 76 - 232
Fln protein:
I
Protein Length:
77
Fln nts:
G
Fln Alignment:
AllPine_a_rep_c96594___SPNWVTLICVLSACCHAGLVDEGQRHFNCMSEHYHITPTMDHYSCMVDLLGRAGHLDEAEEFIKKMPIKPDVSVW
D5AB53________________SPNQVTFVGVLSACCHAGLVSEGRQYFNSMSVDYHITPVMEHYCCMVDLLGRTGCLDEAHDFINKMPIEPDTAVW
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain