UniGene Name: sp_v3.0_unigene137969
Length: 239 nt
![]() |
---|
>sp_v3.0_unigene137969
T |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Pentatricopeptide repeat protein (Fragment) n=1 Tax=Pilularia globulifera RepID=B3U1T7_9MONI | - | - | 2.0e-25 | 64% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 65% |
Sma3 | Pentatricopeptide repeat protein | - | - | 0.0 | - |
Source | Gene names |
---|---|
Sma3 | At1g09410; At1g47580; At1g56690; At2g22070; At2g27610; At3g02010; At3g23330; At3g24000; At3g26782; At4g30700; At4g33170; At4g37380; At5g06540; At5g39680; At5g46460; At5g48910; B1080A02.28; DYW9; EMB2744; F10A12.28; F14J9.7; F14O13.19; F15K20.29; F15M7.7; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | ribosome | GO:0005840 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of ribosome | GO:0003735 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
Sma3 | acireductone synthase activity | GO:0043874 | Molecular Function | 0.0 | - |
Sma3 | metal ion binding | GO:0046872 | Molecular Function | 0.0 | - |
Sma3 | DNA methylation | GO:0006306 | Biological Process | 0.0 | - |
Sma3 | translation | GO:0006412 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | L-methionine salvage from methylthioadenosine | GO:0019509 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT4G33170.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr4:15995701-15998673 REVERSE LENGTH=990 | 1.0e-29 | 62% |
RefSeq | Arabidopsis thaliana | NP_195043.1 | pentatricopeptide repeat-containing protein [Arabidopsis thaliana] | 2.0e-29 | 62% |
RefSeq | Populus trichocarpa | XP_002324099.1 | predicted protein [Populus trichocarpa] | 3.0e-31 | 65% |
![]() |
---|
Fln status: Putative C-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AAE0
Fln msg: STOP codon was not found. Distance to subject end: 12 aas, your sequence is shorter than subject: 79 - 246
Fln protein:
Y
Protein Length:
80
Fln nts:
T
Fln Alignment:
AllPine_a_rep_c96323___YLHDIDCVLHDIDDENKEHSLHYHSEKLAVCFGLISTPPGTPIHVMKNLRVCRDCHTTIKLISKIVSRELVVRDANRFH
D5AAE0________________YVPDTNFVLHDVEMEQKEHSLYHHSEKLAIAFGLISTLPGLPVRIIKNLRVCGDCHTATKFISKIVEREIIIRDANRFH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain