|
||||||
|
UniGene Name: sp_v3.0_unigene137734
Length: 165 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene137734
G |
|
Ace file of the UniGene sp_v3.0_unigene137734
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | myb-like transcription factor 1 [Gossypium hirsutum] | - | - | 3.0e-24 | 94% |
| FL-Next | tr=R2R3-MYB transcription factor MYB13; Picea glauca (White spruce) (Pinus glauca). | - | - | 0.0 | 92% |
| Sma3 | MYB transcription factor | - | - | 2.15e-28 | - |
| Source | Gene names |
|---|---|
| Sma3 | 23.t00069; 40.t00054; AT4g12350; AT4g21440; At1g22640; At1g35515; At1g71030; At2g16720; At3g02940; At3g13540; At3g61250; At4g05100; At4g09460; At4g12350; At4g17785; At4g21440; At4g22680; At4g34990; At4g38620; At5g10280; At5g16770; At5g54230; At5g54230/MDK |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | DNA binding | GO:0003677 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | methyltransferase activity | GO:0008168 | Molecular Function | 0.0 | - |
| Sma3 | cysteine-type peptidase activity | GO:0008234 | Molecular Function | 0.0 | - |
| Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
| Sma3 | proteolysis | GO:0006508 | Biological Process | 0.0 | - |
| Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
| Sma3 | cold acclimation | GO:0009631 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | anthocyanin biosynthetic process | GO:0009718 | Biological Process | 0.0 | - |
| Sma3 | response to ethylene stimulus | GO:0009723 | Biological Process | 0.0 | - |
| Sma3 | response to auxin stimulus | GO:0009733 | Biological Process | 0.0 | - |
| Sma3 | response to abscisic acid stimulus | GO:0009737 | Biological Process | 0.0 | - |
| Sma3 | response to gibberellin stimulus | GO:0009739 | Biological Process | 0.0 | - |
| Sma3 | response to salicylic acid stimulus | GO:0009751 | Biological Process | 0.0 | - |
| Sma3 | response to jasmonic acid stimulus | GO:0009753 | Biological Process | 0.0 | - |
| Sma3 | cinnamic acid biosynthetic process | GO:0009800 | Biological Process | 0.0 | - |
| Sma3 | negative regulation of metabolic process | GO:0009892 | Biological Process | 0.0 | - |
| Sma3 | proanthocyanidin biosynthetic process | GO:0010023 | Biological Process | 0.0 | - |
| Sma3 | trichome morphogenesis | GO:0010090 | Biological Process | 0.0 | - |
| Sma3 | response to UV-B | GO:0010224 | Biological Process | 0.0 | - |
| Sma3 | GO:0016481 | Biological Process | 0.0 | - | |
| Sma3 | GO:0045449 | Biological Process | 0.0 | - | |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | mucilage biosynthetic process involved in seed coat development | GO:0048354 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | SANT/Myb domain | IPR001005 | - | 0.0 | - |
| Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
| Sma3 | Peptidase C48, SUMO/Sentrin/Ubl1 | IPR003653 | - | 0.0 | - |
| Sma3 | Transposon, En/Spm-like | IPR004242 | - | 0.0 | - |
| Sma3 | IPR012287 | - | 0.0 | - | |
| Sma3 | IPR014778 | - | 0.0 | - | |
| Sma3 | Myb transcription factor | IPR015495 | - | 0.0 | - |
| Sma3 | Myb domain, DNA-binding | IPR017930 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G09460.1 | AtMYB6, MYB6 myb domain protein 6 chr4:5993019-5994038 FORWARD LENGTH=236 | 2.0e-31 | 90% |
| RefSeq | Arabidopsis thaliana | NP_192684.1 | transcription repressor MYB6 [Arabidopsis thaliana] | 3.0e-31 | 90% |
| RefSeq | Populus trichocarpa | XP_002325546.1 | predicted protein [Populus trichocarpa] | 4.0e-31 | 90% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A5JYF7
Fln msg: Distance to subject end: 67 aas, your sequence is shorter than subject: 54 - 196
Fln protein:
E
Protein Length:
55
Fln nts:
G
Fln Alignment:
AllPine_a_rep_c95873___EDELIIKLHALLGNKWSLIAGRLPGRTDNEIKNYWNTHIKRKLLSRGLDPQTHR
A5JYF7________________EDDLIIKLHSLLGNKWSLIAGRLPGRTDNEIKNYWNTHMKRKLLSRGLDPQSHR
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
