UniGene Name: sp_v3.0_unigene137720
Length: 198 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene137720
A |
Ace file of the UniGene sp_v3.0_unigene137720
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | 14-3-3 domain containing protein | - | - | 2.0e-28 | 65% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 89% |
| Sma3 | 14-3-3 protein | - | - | 0.0 | - |
| Source | Gene names |
|---|---|
| Sma3 | 117M18_25; 14-3-3; 14-3-3 a-1; 14-3-3 b-1; 14-3-3 b-2; 14-3-3 c-1; 14-3-3 c-2; 14-3-3 d-1; 14-3-3 d-2; 14-3-3 e-1; 14-3-3 e-2; 14-3-3 f-1; 14-3-3 f-2; 14-3-3 g-1; 14-3-3 h-1; 14-3-3 h-2; 14-3-3 i-1; 14-3-3 i-2; 14-3-3EB9D; 14-3-3P20-1; 14-3-3P20-2; 14-3-3 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
| Sma3 | cytosol | GO:0005829 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | endonuclease activity | GO:0004519 | Molecular Function | 0.0 | - |
| Sma3 | phospholipase A2 activity | GO:0004623 | Molecular Function | 0.0 | - |
| Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | protein domain specific binding | GO:0019904 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylated amino acid binding | GO:0045309 | Molecular Function | 0.0 | - |
| Sma3 | ATPase binding | GO:0051117 | Molecular Function | 0.0 | - |
| Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
| Sma3 | brassinosteroid mediated signaling pathway | GO:0009742 | Biological Process | 0.0 | - |
| Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | 14-3-3 protein | IPR000308 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT2G42590.3 | GRF9, GF14 MU general regulatory factor 9 chr2:17732164-17733775 REVERSE LENGTH=276 | 2.0e-27 | 77% |
| RefSeq | Arabidopsis thaliana | NP_001031532.1 | 14-3-3-like protein GF14 mu [Arabidopsis thaliana] | 2.0e-27 | 77% |
| RefSeq | Populus trichocarpa | XP_002330721.1 | predicted protein [Populus trichocarpa] | 3.0e-30 | 80% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PSS3
Fln msg: Distance to subject end: 79 aas, your sequence is shorter than subject: 66 - 259
Fln protein:
N
Protein Length:
67
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c95849___IGESTVFFFTLAGVYYRYLAEFKTGNERKEAADQSLKAYQTASSTAESDLAPTHPIRLGLALNF
C0PSS3________________IGESTVFYYKMKGDYFRYLAEFKTGNERKEAADQSLKAYQTASSTAESDLAPTHPIRLGLALNF

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta