|
||||||
|
UniGene Name: sp_v3.0_unigene137719
Length: 208 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
 UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene137719
A |
|
Ace file of the UniGene sp_v3.0_unigene137719 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Unassigned protein | - | - | 0.0 | - |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 68% |
| Sma3 | Pentatricopeptide repeat-containing protein, putative | - | - | 3.013e-11 | - |
| Source | Gene names |
|---|---|
| Sma3 | At1g05750; At1g06140; At1g68930; At1g74400; At1g74600; At2g01510; At2g13600; At2g36730; At3g49170; At4g16835; At4g22765; At5g19020; At5g40410; B1080A02.28; DYW10; EMB2261; F13K3.13; F1M20.28; F1M20.8; F2I9.13; F2K15.30; FCAALL.441; GSVIVT00000138001; GSVI |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | lipid binding | GO:0008289 | Molecular Function | 0.0 | - |
| Sma3 | deaminase activity | GO:0019239 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | lipid transport | GO:0006869 | Biological Process | 0.0 | - |
| Sma3 | purine ribonucleoside monophosphate biosynthetic process | GO:0009168 | Biological Process | 0.0 | - |
| Sma3 | embryo development ending in seed dormancy | GO:0009793 | Biological Process | 0.0 | - |
| Sma3 | RNA metabolic process | GO:0016070 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT4G16835.1 | Tetratricopeptide repeat (TPR)-like superfamily protein chr4:9472763-9474803 FORWARD LENGTH=656 | 2.0e-21 | 59% |
| RefSeq | Arabidopsis thaliana | NP_680717.2 | tetratricopeptide repeat domain-containing protein [Arabidopsis thaliana] | 3.0e-21 | 59% |
| RefSeq | Populus trichocarpa | XP_002314911.1 | predicted protein [Populus trichocarpa] | 6.0e-23 | 68% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AB53
Fln msg: Distance to subject end: 33 aas, your sequence is shorter than subject: 68 - 232
Fln protein:
H
Protein Length:
69
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c95844___VTFTGVLSACSHAGLVVEGCRYFNSMIQDHCITPIPDHYGCMIDLLGRAGRLMEAVVFINNMPFEP
D5AB53________________VTFVGVLSACCHAGLVSEGRQYFNSMSVDYHITPVMEHYCCMVDLLGRTGCLDEAHDFINKMPIEP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
