UniGene Name: sp_v3.0_unigene137682
Length: 203 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense)
|
|---|
| >sp_v3.0_unigene137682
C |
Ace file of the UniGene sp_v3.0_unigene137682 (antisense)
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Caffeic acid O-3-methyltransferase-like protein (Fragment) n=6 Tax=Pinus taeda RepID=B2CBW1_PINTA | - | - | 2.0e-21 | 75% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 75% |
| Sma3 | Caffeic acid 3-O-methyltransferase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Catechol O-methyltransferase. | EC:2.1.1.6 | - | 2.215e-08 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Steroid hormone biosynthesis | 00140 | 2.215e-08 | % | |
| Sma3 | Tyrosine metabolism | 00350 | 2.215e-08 | % | |
| Sma3 | Betalain biosynthesis | 00965 | 2.215e-08 | % | |
| Sma3 | Metabolic pathways | 01100 | 2.215e-08 | % | |
| Sma3 | Caffeate O-methyltransferase. | EC:2.1.1.68 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Phenylpropanoid biosynthesis | 00940 | 0.0 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % | |
| Sma3 | Quercetin 3-O-methyltransferase. | EC:2.1.1.76 | - | 4.85e-07 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavone and flavonol biosynthesis | 00944 | 4.85e-07 | % |
| Source | Gene names |
|---|---|
| Sma3 | At5g54160; COMT; COMT1; COMT2; COMT2-2A; CtCAldOMT1; GSVIVT00037163001; HOMT1; HOMT3; IhCOMT; K18G13.3; LOC_Os08g06100; OMT; OMT I-a; OMT I-b; OMT1; OMT2; OMT3; OMT4; OMT5; Omt II; Os08g0157500; OsI_27880; OsJ_26105; P0438H08.29; POPTRDRAFT_824484; POPTRD |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
| Sma3 | cytoplasm | GO:0005737 | Cellular Component | 0.0 | - |
| Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
| Sma3 | O-methyltransferase activity | GO:0008171 | Molecular Function | 0.0 | - |
| Sma3 | catechol O-methyltransferase activity | GO:0016206 | Molecular Function | 0.0 | - |
| Sma3 | quercetin 3-O-methyltransferase activity | GO:0030755 | Molecular Function | 0.0 | - |
| Sma3 | myricetin 3'-O-methyltransferase activity | GO:0033799 | Molecular Function | 0.0 | - |
| Sma3 | protein dimerization activity | GO:0046983 | Molecular Function | 0.0 | - |
| Sma3 | caffeate O-methyltransferase activity | GO:0047763 | Molecular Function | 0.0 | - |
| Sma3 | lignin biosynthetic process | GO:0009809 | Biological Process | 0.0 | - |
| Sma3 | flavonol biosynthetic process | GO:0051555 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Ornithine/DAP/Arg decarboxylase | IPR000183 | - | 0.0 | - |
| Sma3 | O-methyltransferase, family 2 | IPR001077 | - | 0.0 | - |
| Sma3 | Phosphopantetheine attachment site | IPR006162 | - | 0.0 | - |
| Sma3 | Winged helix-turn-helix transcription repressor DNA-binding | IPR011991 | - | 0.0 | - |
| Sma3 | Plant methyltransferase dimerisation | IPR012967 | - | 0.0 | - |
| Sma3 | O-methyltransferase, COMT, eukaryota | IPR016461 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G54160.1 | ATOMT1, OMT1 O-methyltransferase 1 chr5:21982075-21984167 FORWARD LENGTH=363 | 3.0e-19 | 56% |
| RefSeq | Arabidopsis thaliana | NP_200227.1 | Quercetin 3-O-methyltransferase 1 [Arabidopsis thaliana] | 4.0e-19 | 56% |
| RefSeq | Populus trichocarpa | XP_002317838.1 | caffeic acid 3-O-methyltransferase [Populus trichocarpa] | 5.0e-20 | 56% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LRV0
Fln msg: Distance to subject end: 166 aas, your sequence is shorter than subject: 67 - 365
Fln protein:
Q
Protein Length:
68
Fln nts:
C
Fln Alignment:
AllPine_a_rep_c95765___QDKVMMESLYYLKDAVLEDSHPFTKAHGMKALEYLAIDRRFNRLFNRAMSETSSMLMNKILDRYEG
B8LRV0________________QDKVLMETWYYLKDAVLEGSQPFTKAHGMNAFEYTAMDQRFNRLFNRSMSEYSIMLMNKIMDSYQG

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta (sense)