|
||||||
|
UniGene Name: sp_v3.0_unigene137664
Length: 169 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene137664
A |
|
Ace file of the UniGene sp_v3.0_unigene137664
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Malate dehydrogenase n=1 Tax=Pinus pinaster RepID=F4MKL8_PINPS | - | - | 1.0e-11 | 94% |
| FL-Next | sp=Malate dehydrogenase; Pinus pinaster (Maritime pine). | - | - | 0.0 | 94% |
| Sma3 | Malate dehydrogenase | - | - | 5.60519e-45 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Malate dehydrogenase. | EC:1.1.1.37 | - | 0.0 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Citrate cycle (TCA cycle) | 00020 | 0.0 | % | |
| Sma3 | Pyruvate metabolism | 00620 | 0.0 | % | |
| Sma3 | Glyoxylate and dicarboxylate metabolism | 00630 | 0.0 | % | |
| Sma3 | Methane metabolism | 00680 | 0.0 | % | |
| Sma3 | Carbon fixation in photosynthetic organisms | 00710 | 0.0 | % | |
| Sma3 | Carbon fixation pathways in prokaryotes | 00720 | 0.0 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 0.0 | % | |
| Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from histidine and purine | 01065 | 0.0 | % | |
| Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 0.0 | % | |
| Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
| Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g53240; At3g15020; CHLREDRAFT_60444; F12M16.14; GSVIVT00027787001; GSVIVT00035904001; K15M2.16; MDH; MDH4; MMDH; MMDHI; Mdh1; OJ1268_B08.7; OJ1316_H05.27; OJ1735_C10.25; OSTLU_24671; Os01g0649100; Os05g0574400; OsI_03070; OsI_21084; OsJ_02822; OsJ_1963 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | mitochondrial matrix | GO:0005759 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
| Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
| Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
| Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
| Sma3 | L-malate dehydrogenase activity | GO:0030060 | Molecular Function | 0.0 | - |
| Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
| Sma3 | glycolysis | GO:0006096 | Biological Process | 0.0 | - |
| Sma3 | tricarboxylic acid cycle | GO:0006099 | Biological Process | 0.0 | - |
| Sma3 | malate metabolic process | GO:0006108 | Biological Process | 0.0 | - |
| Sma3 | response to cold | GO:0009409 | Biological Process | 0.0 | - |
| Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
| Sma3 | defense response to bacterium | GO:0042742 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Lactate/malate dehydrogenase, N-terminal | IPR001236 | - | 0.0 | - |
| Sma3 | Malate dehydrogenase, active site | IPR001252 | - | 0.0 | - |
| Sma3 | L-lactate/malate dehydrogenase | IPR001557 | - | 0.0 | - |
| Sma3 | Malate dehydrogenase, type 1 | IPR010097 | - | 0.0 | - |
| Sma3 | Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal | IPR015955 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G15020.1 | mMDH2 Lactate/malate dehydrogenase family protein chr3:5056139-5057941 FORWARD LENGTH=341 | 7.0e-12 | 76% |
| RefSeq | Arabidopsis thaliana | NP_001078156.1 | malate dehydrogenase 2 [Arabidopsis thaliana] | 8.0e-12 | 76% |
| RefSeq | Populus trichocarpa | XP_002305754.1 | predicted protein [Populus trichocarpa] | 4.0e-13 | 84% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: F4MKL8
Fln msg: Unexpected STOP codon at 3' end. Distance to subject end: 70 aas, your sequence is shorter than subject: 42 - 354
Fln protein:
N
Protein Length:
43
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c95715___PNSVLSEEDIKALTKRTQDGGTEVVEPKAGKDSATLSMA
F4MKL8________________PNSVLSEEDIKALTKRTQDGGTEVVEAKAGKGSATLSMA
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
