UniGene Name: sp_v3.0_unigene137461
Length: 207 nt
This UniGene was originaly assembled in antisense
ACE File: antisense
Fasta: sense
UniGene Fasta (sense) |
---|
>sp_v3.0_unigene137461
T |
Ace file of the UniGene sp_v3.0_unigene137461 (antisense) |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Cinnamyl alcohol dehydrogenase, putative; 82967-79323 n=4 Tax=Arabidopsis RepID=Q9C8J3_ARATH | - | - | 1.0e-17 | 82% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 82% |
Sma3 | Cinnamoyl CoA reductase-like protein | - | - | 5.909e-18 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Dihydrokaempferol 4-reductase. | EC:1.1.1.219 | - | 1.566e-15 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Flavonoid biosynthesis | 00941 | 1.566e-15 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.566e-15 | % | |
Sma3 | Metabolic pathways | 01100 | 1.566e-15 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.566e-15 | % |
Source | Gene names |
---|---|
Sma3 | ADH; ADH2; At1g09490; At1g09500; At1g51410; At5g58490; B1129H01.17; CAD; CAD1; CAD1-1; CAD1-7; CAD2; CCRL1; CCRL2; CCRL3; CCRL4; CCRL5; F14J9.14; F14J9.15; F14J9.16; F14J9.17; F4N21_7; F5D21.12; GSVIVT00000921001; GSVIVT00001374001; GSVIVT00001667001; GSV |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | RNA binding | GO:0003723 | Molecular Function | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | 3-beta-hydroxy-delta5-steroid dehydrogenase activity | GO:0003854 | Molecular Function | 0.0 | - |
Sma3 | RNA-directed DNA polymerase activity | GO:0003964 | Molecular Function | 0.0 | - |
Sma3 | binding | GO:0005488 | Molecular Function | 0.0 | - |
Sma3 | coenzyme binding | GO:0050662 | Molecular Function | 0.0 | - |
Sma3 | RNA-dependent DNA replication | GO:0006278 | Biological Process | 0.0 | - |
Sma3 | steroid biosynthetic process | GO:0006694 | Biological Process | 0.0 | - |
Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
Sma3 | cellular metabolic process | GO:0044237 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Reverse transcriptase | IPR000477 | - | 0.0 | - |
Sma3 | Chromo domain/shadow | IPR000953 | - | 0.0 | - |
Sma3 | NAD-dependent epimerase/dehydratase | IPR001509 | - | 0.0 | - |
Sma3 | 3-beta hydroxysteroid dehydrogenase/isomerase | IPR002225 | - | 0.0 | - |
Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G51410.1 | NAD(P)-binding Rossmann-fold superfamily protein chr1:19059885-19061424 FORWARD LENGTH=325 | 5.0e-24 | 82% |
RefSeq | Arabidopsis thaliana | NP_175552.2 | Rossmann-fold NAD(P)-binding domain-containing protein [Arabidopsis thaliana] | 7.0e-24 | 82% |
RefSeq | Populus trichocarpa | XP_002314079.1 | cinnamoyl CoA reductase-like protein [Populus trichocarpa] | 8.0e-22 | 76% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NK67
Fln msg: Distance to subject end: 188 aas, your sequence is shorter than subject: 68 - 326
Fln protein:
D
Protein Length:
69
Fln nts:
T
Fln Alignment:
AllPine_a_rep_c95325___DAAVDGCEGVFHTASPFYTSVKDPQAELLDPAVKGTINVLNACAKASSVRRHHVNDEI
A9NK67________________DAAVDGCEGVFHTASPFYIGVKDPQAELLDPAVKGTLNVLNACAKASSVKRVVVTSSV
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain