UniGene Name: sp_v3.0_unigene137460
Length: 217 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene137460
C |
Ace file of the UniGene sp_v3.0_unigene137460
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | UDP-glucose dehydrogenase [Cinnamomum osmophloeum] | - | - | 4.0e-27 | 87% |
| FL-Next | sp=UDP-glucose 6-dehydrogenase; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
| Sma3 | UDP-glucose dehydrogenase | - | - | 2.868e-32 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | UDP-glucose 6-dehydrogenase. | EC:1.1.1.22 | - | 1.242e-35 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Pentose and glucuronate interconversions | 00040 | 1.242e-35 | % | |
| Sma3 | Ascorbate and aldarate metabolism | 00053 | 1.242e-35 | % | |
| Sma3 | Starch and sucrose metabolism | 00500 | 1.242e-35 | % | |
| Sma3 | Amino sugar and nucleotide sugar metabolism | 00520 | 1.242e-35 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.242e-35 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.242e-35 | % |
| Source | Gene names |
|---|---|
| Sma3 | At1g26570; At3g29360; At5g15490; At5g39320; CHLREDRAFT_129524; CHLREDRAFT_185081; CHLREDRAFT_205498; CHLREDRAFT_40374; EZY12; GSVIVT00016253001; GSVIVT00021053001; GSVIVT00030060001; K3K3.170; LOC_Os03g31210; LOC_Os03g40720; LOC_Os03g55070; LOC_Os12g25690 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
| Sma3 | UDP-glucose 6-dehydrogenase activity | GO:0003979 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor | GO:0016616 | Molecular Function | 0.0 | - |
| Sma3 | NAD binding | GO:0051287 | Molecular Function | 0.0 | - |
| Sma3 | metabolic process | GO:0008152 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | UDP-glucose/GDP-mannose dehydrogenase, N-terminal | IPR001732 | - | 0.0 | - |
| Sma3 | Dehydrogenase, multihelical | IPR013328 | - | 0.0 | - |
| Sma3 | UDP-glucose/GDP-mannose dehydrogenase, dimerisation | IPR014026 | - | 0.0 | - |
| Sma3 | UDP-glucose/GDP-mannose dehydrogenase, C-terminal | IPR014027 | - | 0.0 | - |
| Sma3 | IPR014028 | - | 0.0 | - | |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | Nucleotide sugar dehydrogenase | IPR017476 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT1G26570.1 | UGD1, ATUGD1 UDP-glucose dehydrogenase 1 chr1:9182801-9184246 FORWARD LENGTH=481 | 5.0e-32 | 83% |
| RefSeq | Arabidopsis thaliana | NP_173979.1 | UDP-glucose dehydrogenase 1 [Arabidopsis thaliana] | 7.0e-32 | 83% |
| RefSeq | Populus trichocarpa | XP_002306064.1 | predicted protein [Populus trichocarpa] | 4.0e-33 | 87% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQ50
Fln msg: Distance to subject end: 186 aas, your sequence is shorter than subject: 72 - 480
Fln protein:
Q
Protein Length:
73
Fln nts:
C
Fln Alignment:
AllPine_a_rep_c95324___QRISSVNAMSALS*SFLTGADVTEVAYAVGKDSRIGPKFLNASVGFGGSCFQKGILNLIYICECNGLIEVAN
B8LQ50________________QRISSVNAMSALCEA--TGADVTEVAYAVGKDSRIGPKFLNASVGFGGSCFQKDILNLIYICECNGLVEVAN

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta