UniGene Name: sp_v3.0_unigene137375
Length: 198 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene137375
A |
Ace file of the UniGene sp_v3.0_unigene137375
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Receptor-like kinase (Fragment) n=1 Tax=Hordeum vulgare RepID=Q9SWU6_HORVU | - | - | 2.0e-14 | 59% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 45% |
| Sma3 | Putative rust resistance kinase Lr10 | - | - | 1.72e-11 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | [Myosin light-chain] kinase. | EC:2.7.11.18 | - | 1.132e-06 | - |
| Source | Gene names |
|---|---|
| Sma3 | GSVIVT00005229001; GSVIVT00007886001; GSVIVT00008482001; GSVIVT00011200001; GSVIVT00011312001; GSVIVT00013745001; GSVIVT00030421001; GSVIVT00031347001; GSVIVT00037120001; GSVIVT00037785001; Hv3Lrk; OJ1212_B09.3; OJ1212_B09.4; OJ1351_C05.109; OJ1417_E01.13 |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
| Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
| Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
| Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
| Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
| Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G24080.1 | Protein kinase superfamily protein chr5:8139334-8141014 REVERSE LENGTH=470 | 7.0e-16 | 56% |
| RefSeq | Arabidopsis thaliana | NP_568438.1 | protein kinase family protein [Arabidopsis thaliana] | 9.0e-16 | 56% |
| RefSeq | Populus trichocarpa | XP_002336724.1 | predicted protein, partial [Populus trichocarpa] | 7.0e-19 | 58% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: A9NM60
Fln msg: Distance to subject end: 230 aas, your sequence is shorter than subject: 65 - 431
Fln protein:
M
Protein Length:
66
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c95127___SLVAVK-LLDRHRHSEAQFMNEVATIGHVHHVNLVRLLGFCFESFTSALLYEYMPNKSLDNFIF
A9NM60________________TLVAVKCLVNESRQGQAEFCAEIGTTSSINHSNLVRLHGICVEGQHRILVYEFMANGSLDRWLF

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta