|
||||||
|
UniGene Name: sp_v3.0_unigene137168
Length: 237 nt
 UniGene Fasta
|
|---|
| >sp_v3.0_unigene137168
A |
|
Ace file of the UniGene sp_v3.0_unigene137168
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
| Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Flavanone-3-hydroxylase (Fragment) n=11 Tax=Cupressaceae RepID=Q8LSU4_CRYJA | - | - | 3.0e-26 | 91% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 93% |
| Sma3 | Flavanone 3-hydroxylase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavanone 3-dioxygenase. | EC:1.14.11.9 | - | 4.436e-36 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonoid biosynthesis | 00941 | 4.436e-36 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 4.436e-36 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.436e-36 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 4.436e-36 | % |
| Source | Gene names |
|---|---|
| Sma3 | AN3; AT3G51240.1; CitF3H; CtF3H; EgF3H; F3H; F3H-1; F3H-2; F3H-A; F3H-A1; F3H-B1; F3H-B2; F3H-D1; F3H-FL1; F3H1; F3H2; F3H4; F3H6; FHT; FrF3H1; GSVIVT00014419001; GSVIVT00036782001; GSVIVT00038884001; GtF3H-1; GtF3H-2; IhF3H1; IhF3H2; IhF3H3; LsF3H; MdF3H |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity | GO:0016491 | Molecular Function | 0.0 | - |
| Sma3 | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen | GO:0016702 | Molecular Function | 0.0 | - |
| Sma3 | L-ascorbic acid binding | GO:0031418 | Molecular Function | 0.0 | - |
| Sma3 | naringenin 3-dioxygenase activity | GO:0045486 | Molecular Function | 0.0 | - |
| Sma3 | flavonoid biosynthetic process | GO:0009813 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Isopenicillin N synthase | IPR002283 | - | 0.0 | - |
| Sma3 | Oxoglutarate/iron-dependent oxygenase | IPR005123 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT3G51240.1 | F3H, TT6, F3'H flavanone 3-hydroxylase chr3:19025409-19026658 FORWARD LENGTH=358 | 1.0e-30 | 82% |
| RefSeq | Arabidopsis thaliana | NP_001190050.1 | Naringenin,2-oxoglutarate 3-dioxygenase [Arabidopsis thaliana] | 6.0e-31 | 82% |
| RefSeq | Populus trichocarpa | XP_002338387.1 | flavanone 3-hydroxylase, partial [Populus trichocarpa] | 2.0e-30 | 80% |
| Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A9Q0
Fln msg: Distance to subject end: 74 aas, your sequence is shorter than subject: 79 - 359
Fln protein:
N
Protein Length:
80
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c94660___PKCPQPDFMTLGLKRHTDPGVITLLLQDQVGGLQATKDDGKNWITVEPIQGAVVVNLGDHMH
D5A9Q0________________PKCPEPD-MTLGLKRHTDPGTITLLLQDQVGGLQATKDDGKNWITVEPIQGAFVVNLGDHMH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
