UniGene Name: sp_v3.0_unigene136235
Length: 233 nt
UniGene Fasta |
---|
>sp_v3.0_unigene136235
A |
Ace file of the UniGene sp_v3.0_unigene136235 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Hydrolase, hydrolyzing O-glycosyl compounds, putative n=1 Tax=Ricinus communis RepID=B9RN03_RICCO | - | - | 7.0e-23 | 64% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 50% |
Sma3 | Mannan endo-1,4-beta-mannosidase 3 | - | - | 2.258e-11 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Mannan endo-1,4-beta-mannosidase. | EC:3.2.1.78 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fructose and mannose metabolism | 00051 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | At1g02310; At2g20680; At3g10890; At3g10900; At5g01930; At5g66460; F5H14.35; GSVIVT00014580001; GSVIVT00024894001; GSVIVT00032044001; GSVIVT00032045001; GSVIVT00032046001; GSVIVT00032047001; GSVIVT00032048001; GSVIVT00032050001; GSVIVT00037511001; GSVIVT00 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | extracellular region | GO:0005576 | Cellular Component | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
Sma3 | mannan endo-1,4-beta-mannosidase activity | GO:0016985 | Molecular Function | 0.0 | - |
Sma3 | cation binding | GO:0043169 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Protein kinase, catalytic domain | IPR000719 | - | 0.0 | - |
Sma3 | Serine-threonine/tyrosine-protein kinase catalytic domain | IPR001245 | - | 0.0 | - |
Sma3 | Bulb-type lectin domain | IPR001480 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 5 | IPR001547 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, subgroup, catalytic domain | IPR013781 | - | 0.0 | - |
Sma3 | Protein kinase, ATP binding site | IPR017441 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 5, conserved site | IPR018087 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT3G10900.1 | Glycosyl hydrolase superfamily protein chr3:3410252-3412070 REVERSE LENGTH=408 | 2.0e-27 | 59% |
RefSeq | Arabidopsis thaliana | NP_187701.1 | putative mannan endo-1,4-beta-mannosidase 4 [Arabidopsis thaliana] | 3.0e-27 | 59% |
RefSeq | Populus trichocarpa | XP_002327685.1 | predicted protein [Populus trichocarpa] | 5.0e-28 | 66% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5A9Z9
Fln msg: Distance to subject end: 284 aas, your sequence is shorter than subject: 77 - 429
Fln protein:
T
Protein Length:
78
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c93276___REKVTSAFEQAAARGLTVARSWAFNDGNTYRALQTSPGIYDEQVFKGLDFVVAHAKNYGIRLILCFVNN
D5A9Z9________________RHRVKTMLRRGAEMGLTVVRTWAFNDGG-YNALQQFPGTFDERVLRALDFVIVEARRNGLRLIFSLVNN
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain