UniGene Name: sp_v3.0_unigene136187
Length: 206 nt
UniGene Fasta |
---|
>sp_v3.0_unigene136187
A |
Ace file of the UniGene sp_v3.0_unigene136187 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | wall-associated kinase 4-like [Oryza sativa Japonica Group] dbj|BAG94677.1| unnamed protein product [Oryza sativa Japonica Group] | - | - | 3.0e-15 | 57% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 53% |
Source | Gene names |
---|---|
Sma3 | AT5G07280; At1g18390; At1g25390; At1g66880; At1g68690; At2g23450; At5g07280; B1250G12.24; B1469H02.26; EMS1; ESP; EXS; F15H18.11; F15H18.25; F24J5.8; F26B6.10; F2J7.14; F4N21.1; GSVIVT00000553001; GSVIVT00001785001; GSVIVT00005293001; GSVIVT00007369001; G |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | nucleic acid binding | GO:0003676 | Molecular Function | 0.0 | - |
Sma3 | peptidyl-prolyl cis-trans isomerase activity | GO:0003755 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | calcium ion binding | GO:0005509 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | protein folding | GO:0006457 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | meiosis | GO:0007126 | Biological Process | 0.0 | - |
Sma3 | microsporogenesis | GO:0009556 | Biological Process | 0.0 | - |
Sma3 | tapetal cell fate specification | GO:0010234 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G18390.2 | - | 5.0e-19 | 60% |
RefSeq | Arabidopsis thaliana | NP_173275.4 | protein kinase domain-containing protein [Arabidopsis thaliana] | 6.0e-19 | 60% |
RefSeq | Populus trichocarpa | XP_002322064.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-21 | 65% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: B8LQ93
Fln msg: Distance to subject end: 148 aas, your sequence is shorter than subject: 68 - 350
Fln protein:
K
Protein Length:
69
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c93188___LPWNTRFNIAVQTAQALAFLHS-IHPHILHRDVKSSNILLGDNFIAKVADFGLCRLVPVDASHVTT
B8LQ93________________LDWSRRMNIAIGSAEGLAYLHHHATPHIIHRDIKASNVLLDSDFKAQVADFGFAKLIPEGETHVTT
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain