SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene136002

Length: 285 nt

UniGene Fasta

>sp_v3.0_unigene136002
AGGAATCATGGTTGCTGCTGATTCTCGTGCGAGCATGGGAGGATACATTTCATCACAATCTGTGAAGAAAATTATTGAAATCAATCCTTATTTACTTGGTACTATGGCTGGGGGTGCAGCTGATTGCCAATTCTGGCACAGAAACCTGGGAATTAAGTGTCGGTTACATGACCTGTCACTGATATTCTCCGCTTGTTTGCCAGCTCATGTACAATGATTGCCGGATGGGATGAAACGGGCCCTGGTCTATATTATGTAGACAGTGAAGGAGGAAGACTCAAGGGG

Ace file of the UniGene sp_v3.0_unigene136002

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	RecName: Full=Proteasome subunit beta type-5; AltName: Full=20S proteasome subunit E; AltName: Full=Proteasome epsilon chain; Flags: Precursor dbj\|BAA21650.1\| 26S proteasome beta subunit [Spinacia oleracea]	-	-	4.0e-37	93%
FL-Next	sp=Proteasome subunit beta type; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	96%
Sma3	Proteasome subunit beta type 5	-	-	1.895e-08	-

Source	Gene names
Sma3	At1g13060; At3g26340; CHLREDRAFT_127297; F20C19.6; F3F19.8; GSVIVT00002349001; GSVIVT00007118001; GSVIVT00035048001; MICPUCDRAFT_60944; MICPUN_96064; OSJNBa0085L11.4; OSTLU_27330; Os06g0153800; OsI_21721; OsJ_20167; OsPBE1; Ot15g00420; PBE1; PBE2; PHATRDR

Source	GOs	Term	Type	Identity
Sma3	nucleus	GO:0005634	Cellular Component	-
Sma3	cytosol	GO:0005829	Cellular Component	-
Sma3	proteasome core complex	GO:0005839	Cellular Component	-
Sma3	microtubule	GO:0005874	Cellular Component	-
Sma3	microtubule associated complex	GO:0005875	Cellular Component	-
Sma3	membrane	GO:0016020	Cellular Component	-
Sma3	protein complex	GO:0043234	Cellular Component	-
Sma3	microtubule motor activity	GO:0003777	Molecular Function	-
Sma3	GTPase activity	GO:0003924	Molecular Function	-
Sma3	threonine-type endopeptidase activity	GO:0004298	Molecular Function	-
Sma3	inorganic diphosphatase activity	GO:0004427	Molecular Function	-
Sma3	structural molecule activity	GO:0005198	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	GTP binding	GO:0005525	Molecular Function	-
Sma3	hydrogen-translocating pyrophosphatase activity	GO:0009678	Molecular Function	-
Sma3	ubiquitin-dependent protein catabolic process	GO:0006511	Biological Process	-
Sma3	microtubule-based movement	GO:0007018	Biological Process	-
Sma3	proton transport	GO:0015992	Biological Process	-
Sma3	response to cadmium ion	GO:0046686	Biological Process	-
Sma3	protein polymerization	GO:0051258	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	Tubulin	IPR000217	-	-
Sma3	Peptidase T1A, proteasome beta-subunit	IPR000243	-	-
Sma3	Proteasome, subunit alpha/beta	IPR001353	-	-
Sma3	Kinesin, motor domain	IPR001752	-	-
Sma3	Alpha tubulin	IPR002452	-	-
Sma3	Peptidase S9, serine active site	IPR002471	-	-
Sma3	Pyrophosphate-energised proton pump	IPR004131	-	-
Sma3	Proteasome, beta-type subunit, conserved site	IPR016050	-	-
Sma3	Tubulin/FtsZ, 2-layer sandwich domain	IPR018316	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT3G26340.1	N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein chr3:9650600-9652572 REVERSE LENGTH=273	5.0e-39	93%
RefSeq	Arabidopsis thaliana	NP_172765.1	proteasome subunit beta type-5-A [Arabidopsis thaliana]	6.0e-39	93%
RefSeq	Populus trichocarpa	XP_002315619.1	predicted protein [Populus trichocarpa]	8.0e-39	91%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: A9NZ27

Fln msg: Separated hits, possible frame ERROR between 178 and 211, Distance to subject end: 93 aas, your sequence is shorter than subject: 95 - 271

Fln protein: GIMVAADSRASMGGYISSQSVKKIIEINPYLLGTMAGGAADCQFWHRNLGIKCRLHDLxxxxxxxxxxxxTMIAGWDETGPGLYYVDSEGGRLKG

Protein Length: 96

Fln nts: AGGAATCATGGTTGCTGCTGATTCTCGTGCGAGCATGGGAGGATACATTTCATCACAATCTGTGAAGAAAATTATTGAAATCAATCCTTATTTACTTGGTACTATGGCTGGGGGTGCAGCTGATTGCCAATTCTGGCACAGAAACCTGGGAATTAAGTGTCGGTTACATGACCTGTCxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTACAATGATTGCCGGATGGGATGAAACGGGCCCTGGTCTATATTATGTAGACAGTGAAGGAGGAAGACTCAAGGGG

Fln Alignment:

AllPine_a_rep_c92858___GIMVAADSRASMGGYISSQSVKKIIEINPYLLGTMAGGAADCQFWHRNLGIKCRLHDLSxxxxxxxxxxxTMIAGWDETGPGLYYVDSEGGRLKG
A9NZ27________________GIMVAADSRASMGGYISSQSVKKIIEINPYLLGTMAGGAADCQFWHRNLGIKCRLHELAxxxxxxxxxxxTMIAGWDETGPGLYYVDSEGGRLKG

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain