UniGene Name: sp_v3.0_unigene135843
Length: 226 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene135843
T |
Ace file of the UniGene sp_v3.0_unigene135843
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Glutamate synthase, putative n=1 Tax=Ricinus communis RepID=B9RII5_RICCO | - | - | 7.0e-24 | 79% |
| FL-Next | sp=Glutamate synthase 1 [NADH], chloroplastic; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 72% |
| Sma3 | NADH-dependent glutamate synthase | - | - | 5.645e-09 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutamate synthase (NADH). | EC:1.4.1.14 | - | 4.035e-27 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Alanine, aspartate and glutamate metabolism | 00250 | 4.035e-27 | % | |
| Sma3 | Nitrogen metabolism | 00910 | 4.035e-27 | % | |
| Sma3 | Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid | 01064 | 4.035e-27 | % | |
| Sma3 | Metabolic pathways | 01100 | 4.035e-27 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 4.035e-27 | % |
| Source | Gene names |
|---|---|
| Sma3 | CHLREDRAFT_205746; GLT; GLT2; GSN1; GSVIVT00037107001; MICPUCDRAFT_57115; NGS; Os01g0681900; OsI_03285; OsI_20922; OsJ_03025; OsJ_19492; PHYPADRAFT_130231; PHYPADRAFT_132131; PHYPADRAFT_182528; PHYPADRAFT_212395; POPTRDRAFT_594762; POPTRDRAFT_824538; RCOM |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | amyloplast | GO:0009501 | Cellular Component | 0.0 | - |
| Sma3 | chloroplast stroma | GO:0009570 | Cellular Component | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | FMN binding | GO:0010181 | Molecular Function | 0.0 | - |
| Sma3 | glutamate synthase activity | GO:0015930 | Molecular Function | 0.0 | - |
| Sma3 | glutamate synthase (NADH) activity | GO:0016040 | Molecular Function | 0.0 | - |
| Sma3 | glutamate synthase activity, NADH or NADPH as acceptor | GO:0045181 | Molecular Function | 0.0 | - |
| Sma3 | flavin adenine dinucleotide binding | GO:0050660 | Molecular Function | 0.0 | - |
| Sma3 | iron-sulfur cluster binding | GO:0051536 | Molecular Function | 0.0 | - |
| Sma3 | 3 iron, 4 sulfur cluster binding | GO:0051538 | Molecular Function | 0.0 | - |
| Sma3 | glutamate biosynthetic process | GO:0006537 | Biological Process | 0.0 | - |
| Sma3 | glutamine metabolic process | GO:0006541 | Biological Process | 0.0 | - |
| Sma3 | nitrogen compound metabolic process | GO:0006807 | Biological Process | 0.0 | - |
| Sma3 | response to cadmium ion | GO:0046686 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Glutamine amidotransferase, class-II | IPR000583 | - | 0.0 | - |
| Sma3 | IPR000759 | - | 0.0 | - | |
| Sma3 | Pyridine nucleotide-disulphide oxidoreductase, NAD-binding domain | IPR001327 | - | 0.0 | - |
| Sma3 | Glutamate synthase, alpha subunit, C-terminal | IPR002489 | - | 0.0 | - |
| Sma3 | Glutamate synthase, central-C | IPR002932 | - | 0.0 | - |
| Sma3 | Glutamate synthase, NADH/NADPH, small subunit 1 | IPR006005 | - | 0.0 | - |
| Sma3 | Glutamate synthase, central-N | IPR006982 | - | 0.0 | - |
| Sma3 | Glutamate synthase, eukaryotic | IPR012220 | - | 0.0 | - |
| Sma3 | Fumarate reductase, C-terminal | IPR012285 | - | 0.0 | - |
| Sma3 | FAD-dependent pyridine nucleotide-disulphide oxidoreductase | IPR013027 | - | 0.0 | - |
| Sma3 | Aldolase-type TIM barrel | IPR013785 | - | 0.0 | - |
| Sma3 | NAD(P)-binding domain | IPR016040 | - | 0.0 | - |
| Sma3 | Glutamine amidotransferase, type II | IPR017932 | - | 0.0 | - |
| Sma3 | Rhodopsin, retinal binding site | IPR018229 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G53460.1 | GLT1 NADH-dependent glutamate synthase 1 chr5:21700518-21709629 FORWARD LENGTH=2208 | 9.0e-28 | 72% |
| RefSeq | Arabidopsis thaliana | NP_200158.2 | glutamate synthase 1 [NADH] [Arabidopsis thaliana] | 1.0e-27 | 72% |
| RefSeq | Populus trichocarpa | XP_002321436.1 | predicted protein [Populus trichocarpa] | 3.0e-25 | 69% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9LV03
Fln msg: Distance to subject end: 1429 aas, your sequence is shorter than subject: 74 - 2208
Fln protein:
N
Protein Length:
75
Fln nts:
T
Fln Alignment:
AllPine_a_rep_c92569___NYRGWRSKVLDITFPKERGSRGLVVTLAVICSEARLAIREGYKLIVLSDRATSSKRVPVSSLLAVGAVHHHLV
Q9LV03________________NYRGWRTKVLDITYAKERGTKGLEETLDRICDEANEAIKEGYTLLVLSDRAFSATRVAVSSLMAVGAVHHHLV

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta