SustainPineDB

All assemblies
Assembly info
Unigenes
SNPs
SSRs
Descriptions
GOs
ECs
KEGGs
InterPros
miRNAs

Assembly Name: SustainPine v3.0

UniGene Name: sp_v3.0_unigene135715

Length: 270 nt

UniGene Fasta

>sp_v3.0_unigene135715
TACTTTTCTTACTAGCAAGTCAGGAAAGGGAACGCCACAGTGGATGGCTCCGGAAGTACTGAGAAATGAATATTCCAATGAAAAGTCAGATGTTTACAGTTTTGGAGTTATATTATGGGAACTTGCCACTGAGCAGATTCCATGGATTGGTCTCAATTCTATGCAAGTGGTTGGAGCTGTTGGATTTATGAACCAACTATTGCAGATCCCAGAAGGCTTGAATCCTCAATGGACATCCATGATTGAAAGCTGTTGGCACAGTGATCCAAA

Ace file of the UniGene sp_v3.0_unigene135715

If you push the Download ace button, you will download an ace file of this UniGene.

To watch this ACE file you will need an ACE viewer program as Tablet:

Go to the Tablet ACE viewer Web

Annotations

Source	Descriptions	Term	Type	e value	Identity
AutoFact	Map3k delta-1 protein kinase, putative n=1 Tax=Ricinus communis RepID=B9RZR2_RICCO	-	-	2.0e-37	79%
FL-Next	tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis).	-	-	0.0	79%
Sma3	Map3k delta-1 protein kinase, putative	-	-	1.915e-26	-

Source	ECs	Term	Type	e value	Identity
Sma3	Mitogen-activated protein kinase kinase kinase.	EC:2.7.11.25	-	4.519e-12	-

Source	Gene names
Sma3	AT4g23050; AT4g24480; AT5G03730; At1g18160; At1g67890; At1g73660; At3g06620; At3g06630; At3g06640; At4g23050; At4g24480; At5g03730; At5g11850; At5g49470; B1131G07.13; CHLREDRAFT_102541; CTR; CTR1; CTR2; CTR3; CTR4; EDR1; ER50; F14F18_20; F17C15_150; F5E6.

Source	GOs	Term	Type	Identity
Sma3	endoplasmic reticulum membrane	GO:0005789	Cellular Component	-
Sma3	plasma membrane	GO:0005886	Cellular Component	-
Sma3	myosin complex	GO:0016459	Cellular Component	-
Sma3	two-component sensor activity	GO:0000155	Molecular Function	-
Sma3	motor activity	GO:0003774	Molecular Function	-
Sma3	protein serine/threonine kinase activity	GO:0004674	Molecular Function	-
Sma3	protein tyrosine kinase activity	GO:0004713	Molecular Function	-
Sma3	signal transducer activity	GO:0004871	Molecular Function	-
Sma3	protein binding	GO:0005515	Molecular Function	-
Sma3	ATP binding	GO:0005524	Molecular Function	-
Sma3	actin filament binding	GO:0051015	Molecular Function	-
Sma3	two-component signal transduction system (phosphorelay)	GO:0000160	Biological Process	-
Sma3	regulation of transcription, DNA-dependent	GO:0006355	Biological Process	-
Sma3	protein phosphorylation	GO:0006468	Biological Process	-
Sma3	signal transduction	GO:0007165	Biological Process	-
Sma3	gibberellin biosynthetic process	GO:0009686	Biological Process	-
Sma3	response to sucrose stimulus	GO:0009744	Biological Process	-
Sma3	negative regulation of ethylene mediated signaling pathway	GO:0010105	Biological Process	-
Sma3	sugar mediated signaling pathway	GO:0010182	Biological Process	-
Sma3	regulation of timing of transition from vegetative to reproductive phase	GO:0048510	Biological Process	-

Source	InterPros	Term	Type	Identity
Sma3	PAS	IPR000014	-	-
Sma3	IQ motif, EF-hand binding site	IPR000048	-	-
Sma3		IPR000173	-	-
Sma3	Peptidase S8/S53, subtilisin/kexin/sedolisin	IPR000209	-	-
Sma3	Protease inhibitor I4, serpin	IPR000215	-	-
Sma3	ATPase, F0 complex, subunit A	IPR000568	-	-
Sma3	PAS-associated, C-terminal	IPR000700	-	-
Sma3	Protein kinase, catalytic domain	IPR000719	-	-
Sma3	Serine-threonine/tyrosine-protein kinase catalytic domain	IPR001245	-	-
Sma3	BRCT domain	IPR001357	-	-
Sma3	Tetratricopeptide TPR-1	IPR001440	-	-
Sma3	Myosin head, motor domain	IPR001609	-	-
Sma3	PAC motif	IPR001610	-	-
Sma3	Serine/threonine- / dual-specificity protein kinase, catalytic domain	IPR002290	-	-
Sma3	Dilute	IPR002710	-	-
Sma3	Ubiquitin interacting motif	IPR003903	-	-
Sma3	Myosin, N-terminal, SH3-like	IPR004009	-	-
Sma3	Serine/threonine-protein kinase, active site	IPR008271	-	-
Sma3	Tetratricopeptide-like helical	IPR011990	-	-
Sma3	Tetratricopeptide repeat-containing domain	IPR013026	-	-
Sma3	PAS fold	IPR013767	-	-
Sma3	Protein kinase, ATP binding site	IPR017441	-	-
Sma3		IPR017442	-	-
Sma3	Asp/Glu racemase, active site	IPR018187	-	-
Sma3	Dil domain	IPR018444	-	-
Sma3	Tetratricopeptide repeat	IPR019734	-	-

Source	Species	ID	Description	e value	Identity
ATG	Arabidoptis thaliana	AT3G06620.1	PAS domain-containing protein tyrosine kinase family protein chr3:2062833-2067138 REVERSE LENGTH=773	1.96182e-44	76%
RefSeq	Arabidopsis thaliana	NP_199758.2	PAS domain-containing protein tyrosine kinase [Arabidopsis thaliana]	5.60519e-45	73%
RefSeq	Populus trichocarpa	XP_002312329.1	predicted protein [Populus trichocarpa]	0.0	77%

Full-Lengther Next Prediction

Fln status: Internal

Fln database: coniferopsida.fasta

Fln subject: C0PQ12

Fln msg: Distance to subject end: 38 aas, your sequence is shorter than subject: 89 - 835

Fln protein: TFLTSKSGKGTPQWMAPEVLRNEYSNEKSDVYSFGVILWELATEQIPWIGLNSMQVVGAVGFMNQLLQIPEGLNPQWTSMIESCWHSDP

Protein Length: 90

Fln nts: TACTTTTCTTACTAGCAAGTCAGGAAAGGGAACGCCACAGTGGATGGCTCCGGAAGTACTGAGAAATGAATATTCCAATGAAAAGTCAGATGTTTACAGTTTTGGAGTTATATTATGGGAACTTGCCACTGAGCAGATTCCATGGATTGGTCTCAATTCTATGCAAGTGGTTGGAGCTGTTGGATTTATGAACCAACTATTGCAGATCCCAGAAGGCTTGAATCCTCAATGGACATCCATGATTGAAAGCTGTTGGCACAGTGATCCAAA

Fln Alignment:

AllPine_a_rep_c92316___TFLTSKSGKGTPQWMAPEVLRNEYSNEKSDVYSFGVILWELATEQIPWIGLNSMQVVGAVGFMNQLLQIPEGLNPQWTSMIESCWHSD
C0PQ12________________TFLTAKSGKGTPQWMAPEVLRNEPSNEKSDVYSFGVVLWELATEKIPWENLNPMQVVGAVGFMNQRLEISQGLDSHWAAIIESCWHDD

Back

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain