UniGene Name: sp_v3.0_unigene135702
Length: 224 nt
UniGene Fasta |
---|
>sp_v3.0_unigene135702
T |
Ace file of the UniGene sp_v3.0_unigene135702 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | 3-hydroxy-3-methylglutaryl coenzyme A reductase n=1 Tax=Corylus avellana RepID=A9Q0N6_CORAV | - | - | 2.0e-27 | 79% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 77% |
Sma3 | 3-hydroxy-3-methylglutaryl coenzyme A reductase | - | - | 4.37205e-43 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Hydroxymethylglutaryl-CoA reductase (NADPH). | EC:1.1.1.34 | - | 0.0 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Terpenoid backbone biosynthesis | 00900 | 0.0 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 0.0 | % | |
Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 0.0 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 0.0 | % | |
Sma3 | Metabolic pathways | 01100 | 0.0 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 0.0 | % |
Source | Gene names |
---|---|
Sma3 | AHM1; AHM4; At1g76490; At2g17370; Cm-HMGR; F5J6.24; GSVIVT00002942001; GSVIVT00006002001; GSVIVT00036301001; GenHMG1; GenHMG2; HMG1; HMG2; HMG3; HMGR; HMGR1; HMGR2; HMGR3; HMGRL; HMGr; HbHMGR; LOC_Os08g40180; Lehmgr1; Os08g0512700; Os09g0492700; OsI_00850 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
Sma3 | microsome | GO:0005792 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | mitochondrial membrane | GO:0031966 | Cellular Component | 0.0 | - |
Sma3 | plastid membrane | GO:0042170 | Cellular Component | 0.0 | - |
Sma3 | hydroxymethylglutaryl-CoA reductase (NADPH) activity | GO:0004420 | Molecular Function | 0.0 | - |
Sma3 | NADP binding | GO:0050661 | Molecular Function | 0.0 | - |
Sma3 | coenzyme binding | GO:0050662 | Molecular Function | 0.0 | - |
Sma3 | isoprenoid biosynthetic process | GO:0008299 | Biological Process | 0.0 | - |
Sma3 | coenzyme A metabolic process | GO:0015936 | Biological Process | 0.0 | - |
Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Hydroxymethylglutaryl-CoA reductase, class I/II | IPR002202 | - | 0.0 | - |
Sma3 | Hydroxymethylglutaryl-CoA reductase, eukaryotic/arcaheal type | IPR004554 | - | 0.0 | - |
Sma3 | Proteinase inhibitor I25, cystatin, conserved site | IPR018073 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G76490.1 | HMG1, HMGR1, AtHMGR1 hydroxy methylglutaryl CoA reductase 1 chr1:28695801-28698206 FORWARD LENGTH=642 | 5.0e-30 | 66% |
RefSeq | Arabidopsis thaliana | NP_177775.2 | hydroxy methylglutaryl CoA reductase 1 [Arabidopsis thaliana] | 7.0e-30 | 66% |
RefSeq | Populus trichocarpa | XP_002317026.1 | predicted protein [Populus trichocarpa] | 5.0e-31 | 72% |
Full-Lengther Next Prediction |
---|
Fln status: N-terminus
Fln database: coniferopsida.fasta
Fln subject: D5AAJ6
Fln msg: Distance to subject end: 223 aas, atg_distance in limit (1-15): atg_distance = 9, your sequence is shorter than subject: 69 - 305
Fln protein:
M
Protein Length:
70
Fln nts:
T
Fln Alignment:
AllPine_a_rep_c92289___LLRDGMTRAPVVRFPTAERAAQLKSYLEHPKNFDSLSLIFNSTSRFARLQTIKCAIAGRNLYIRFSCFTGDAMG
D5AAJ6________________LLREGMTRAPVVRFPTTKRATDLKFYIEDINNSENLSVIFNSTSRFARLQGIRCAIAGRNLYMRFSCFTGDAMG
SNPs (tot: 1) |
---|
Position | A % | C % | G % | T % | Probability |
---|---|---|---|---|---|
77 | 33 | 66 | 0.997452 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain