UniGene Name: sp_v3.0_unigene135193
Length: 238 nt
UniGene Fasta |
---|
>sp_v3.0_unigene135193
A |
Ace file of the UniGene sp_v3.0_unigene135193 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | fumarase [Solanum tuberosum] | - | - | 9.0e-10 | 63% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 90% |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Fumarate hydratase. | EC:4.2.1.2 | - | 8.293e-08 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Citrate cycle (TCA cycle) | 00020 | 8.293e-08 | % | |
Sma3 | Carbon fixation pathways in prokaryotes | 00720 | 8.293e-08 | % | |
Sma3 | Biosynthesis of phenylpropanoids | 01061 | 8.293e-08 | % | |
Sma3 | Biosynthesis of terpenoids and steroids | 01062 | 8.293e-08 | % | |
Sma3 | Biosynthesis of alkaloids derived from shikimate pathway | 01063 | 8.293e-08 | % | |
Sma3 | Biosynthesis of alkaloids derived from terpenoid and polyketide | 01066 | 8.293e-08 | % | |
Sma3 | Biosynthesis of plant hormones | 01070 | 8.293e-08 | % | |
Sma3 | Metabolic pathways | 01100 | 8.293e-08 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 8.293e-08 | % |
Source | Gene names |
---|---|
Sma3 | AT2G47510; At2g47510; At5g50950; FUM1; FUM2; GSVIVT00022670001; GSVIVT00028048001; K3K7.11; LOC_Os03g21950; MICPUCDRAFT_43834; Os03g0337900; OsI_11478; OsJ_10766; PHYPADRAFT_181428; POPTRDRAFT_552480; T30B22.19; fum1; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | mitochondrion | GO:0005739 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | tricarboxylic acid cycle enzyme complex | GO:0045239 | Cellular Component | 0.0 | - |
Sma3 | catalytic activity | GO:0003824 | Molecular Function | 0.0 | - |
Sma3 | fumarate hydratase activity | GO:0004333 | Molecular Function | 0.0 | - |
Sma3 | tricarboxylic acid cycle | GO:0006099 | Biological Process | 0.0 | - |
Sma3 | fumarate metabolic process | GO:0006106 | Biological Process | 0.0 | - |
Sma3 | response to salt stress | GO:0009651 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Peptidase, cysteine peptidase active site | IPR000169 | - | 0.0 | - |
Sma3 | Fumarate lyase | IPR000362 | - | 0.0 | - |
Sma3 | Regulator of chromosome condensation, RCC1 | IPR000408 | - | 0.0 | - |
Sma3 | Fumarate hydratase, class II | IPR005677 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT2G47510.1 | FUM1 fumarase 1 chr2:19498614-19502020 FORWARD LENGTH=492 | 3.0e-13 | 80% |
RefSeq | Arabidopsis thaliana | NP_001119412.1 | fumarate hydratase 2 [Arabidopsis thaliana] | 2.0e-13 | 78% |
RefSeq | Populus trichocarpa | XP_002302734.1 | predicted protein [Populus trichocarpa] | 2.0e-13 | 78% |
Full-Lengther Next Prediction |
---|
Fln status: C-terminus
Fln database: coniferopsida.fasta
Fln subject: A9NVX1
Fln msg: your sequence is shorter than subject: 56 - 495
Fln protein:
A
Protein Length:
57
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c91511___NPKIGYDXXXXXXXXXXXEGSVVTLAALELGVLTSEEFDELVVPEKMIGPSD
A9NVX1________________NPKIGYDKAAATAKKAHKEGSTLKEAALQLGVLTSEEFDELVVPEKMIGPSD
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain