UniGene Name: sp_v3.0_unigene135157
Length: 204 nt
![]() |
---|
>sp_v3.0_unigene135157
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | Probable beta-D-xylosidase 6 n=2 Tax=Arabidopsis RepID=BXL6_ARATH | - | - | 8.0e-24 | 78% |
FL-Next | sp=Probable beta-D-xylosidase 6; Arabidopsis thaliana (Mouse-ear cress). | - | - | 0.0 | 78% |
Sma3 | Beta-D-xylosidase | - | - | 6.16e-14 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Beta-glucosidase. | EC:3.2.1.21 | - | 8.567e-17 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Cyanoamino acid metabolism | 00460 | 8.567e-17 | % | |
Sma3 | Starch and sucrose metabolism | 00500 | 8.567e-17 | % | |
Sma3 | Phenylpropanoid biosynthesis | 00940 | 8.567e-17 | % | |
Sma3 | Biosynthesis of secondary metabolites | 01110 | 8.567e-17 | % | |
Sma3 | Xylan 1,4-beta-xylosidase. | EC:3.2.1.37 | - | 4.108e-15 | - |
Source | KEGGs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | Starch and sucrose metabolism | 00500 | 4.108e-15 | % | |
Sma3 | Amino sugar and nucleotide sugar metabolism | 00520 | 4.108e-15 | % | |
Sma3 | Metabolic pathways | 01100 | 4.108e-15 | % |
Source | Gene names |
---|---|
Sma3 | ARF; At1g02640; At1g78060; At5g09730; At5g10560; At5g10560/F12B17_90; At5g49360; At5g64570; B1011H02.4; BXL2; BXL3; BXL4; BXL7; F12B17_90; F17I14_80; GSVIVT00001462001; GSVIVT00008537001; GSVIVT00012513001; GSVIVT00015256001; GSVIVT00015257001; GSVIVT0001 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | cell wall | GO:0005618 | Cellular Component | 0.0 | - |
Sma3 | vacuole | GO:0005773 | Cellular Component | 0.0 | - |
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | plant-type cell wall | GO:0009505 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | apoplast | GO:0048046 | Cellular Component | 0.0 | - |
Sma3 | hydrolase activity, hydrolyzing O-glycosyl compounds | GO:0004553 | Molecular Function | 0.0 | - |
Sma3 | xylan 1,4-beta-xylosidase activity | GO:0009044 | Molecular Function | 0.0 | - |
Sma3 | alpha-N-arabinofuranosidase activity | GO:0046556 | Molecular Function | 0.0 | - |
Sma3 | carbohydrate metabolic process | GO:0005975 | Biological Process | 0.0 | - |
Sma3 | xylan catabolic process | GO:0045493 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IPR000173 | - | 0.0 | - | |
Sma3 | Parathyroid hormone/parathyroid hormone-related protein | IPR001415 | - | 0.0 | - |
Sma3 | Glycoside hydrolase, family 3, N-terminal | IPR001764 | - | 0.0 | - |
Sma3 | DNA methylase, N-6 adenine-specific, conserved site | IPR002052 | - | 0.0 | - |
Sma3 | Glycoside hydrolase family 3 C-terminal domain | IPR002772 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G10560.1 | Glycosyl hydrolase family protein chr5:3336335-3339351 REVERSE LENGTH=792 | 3.0e-30 | 78% |
RefSeq | Arabidopsis thaliana | NP_196618.1 | putative beta-D-xylosidase 6 [Arabidopsis thaliana] | 4.0e-30 | 78% |
RefSeq | Populus trichocarpa | XP_002299457.1 | predicted protein [Populus trichocarpa] | 8.0e-28 | 80% |
![]() |
---|
Fln status: Internal
Fln database: sp_plants
Fln subject: Q9LXA8
Fln msg: Distance to subject end: 620 aas, your sequence is shorter than subject: 68 - 792
Fln protein:
R
Protein Length:
69
Fln nts:
C
Fln Alignment:
AllPine_a_rep_c91458___SFPQVILTTASFNQTLWTEIAKAIAIEGRAMYNSAQAGLTFWAPNVNIFRDPRWGRGQETP
Q9LXA8________________SFPQVIVSAASFNRTLWYEIGSAVAVEGRAMYNGGQAGLTFWAPNINVFRDPRWGRGQETP
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain