UniGene Name: sp_v3.0_unigene134758
Length: 220 nt
![]() |
---|
>sp_v3.0_unigene134758
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | AP2 protein n=1 Tax=Elaeis guineensis RepID=A9JQY7_ELAGV | - | - | 1.0e-32 | 96% |
FL-Next | tr=AINTEGUMENTA-like protein; Pinus thunbergii (Japanese black pine) (Pinus thunbergiana). | - | - | 0.0 | 87% |
Sma3 | AP2 domain-containing transcription factor | - | - | 0.0 | - |
Source | ECs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | 2-alkenal reductase. | EC:1.3.1.74 | - | 6.316e-07 | - |
Source | Gene names |
---|---|
Sma3 | 117M18_31; 57h21.37; AIL1; AIL3; AIL4; AIL5; AIL6; AIL7; ANT; ANTL1A; ANTL1B; AP2D10; AP2D14; AP2D16; AP2D4; AP2D8; AP2D9; AP2LP; ASML1; At1g16060; At1g51190; At1g72570; At1g79700; At2g41710; At3g20840; At3g54320; At4g37750; At5g10510; At5g17430; At5g5739 |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | nucleus | GO:0005634 | Cellular Component | 0.0 | - |
Sma3 | sequence-specific DNA binding transcription factor activity | GO:0003700 | Molecular Function | 0.0 | - |
Sma3 | regulation of transcription, DNA-dependent | GO:0006355 | Biological Process | 0.0 | - |
Sma3 | response to stress | GO:0006950 | Biological Process | 0.0 | - |
Sma3 | multicellular organismal development | GO:0007275 | Biological Process | 0.0 | - |
Sma3 | pattern specification process | GO:0007389 | Biological Process | 0.0 | - |
Sma3 | auxin mediated signaling pathway | GO:0009734 | Biological Process | 0.0 | - |
Sma3 | seed germination | GO:0009845 | Biological Process | 0.0 | - |
Sma3 | ethylene mediated signaling pathway | GO:0009873 | Biological Process | 0.0 | - |
Sma3 | flower development | GO:0009908 | Biological Process | 0.0 | - |
Sma3 | stem cell maintenance | GO:0019827 | Biological Process | 0.0 | - |
Sma3 | cell differentiation | GO:0030154 | Biological Process | 0.0 | - |
Sma3 | regulation of cell proliferation | GO:0042127 | Biological Process | 0.0 | - |
Sma3 | root development | GO:0048364 | Biological Process | 0.0 | - |
Source | InterPros | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | IPR000173 | - | 0.0 | - | |
Sma3 | AP2/ERF domain | IPR001471 | - | 0.0 | - |
Sma3 | PRELI/MSF1 | IPR006797 | - | 0.0 | - |
Sma3 | Zein-binding domain | IPR007656 | - | 0.0 | - |
Sma3 | DNA topoisomerase, type IIA, conserved site | IPR018522 | - | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G57390.1 | AIL5, CHO1, EMK AINTEGUMENTA-like 5 chr5:23253459-23256437 REVERSE LENGTH=558 | 9.99995e-41 | 96% |
RefSeq | Arabidopsis thaliana | NP_200549.2 | AP2-like ethylene-responsive transcription factor AIL5 [Arabidopsis thaliana] | 9.99995e-41 | 96% |
RefSeq | Populus trichocarpa | XP_002325046.1 | AP2 domain-containing transcription factor [Populus trichocarpa] | 5.0e-37 | 90% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: Q76H96
Fln msg: Unexpected stop codon in the beginning of your sequence, Distance to subject end: 361 aas, your sequence is shorter than subject: 72 - 606
Fln protein:
S
Protein Length:
73
Fln nts:
C
Fln Alignment:
AllPine_a_rep_c90905___RWTGRYEAHLWDNSCRREGQTRKGRQVYLGGYDKEEKAARAYDLAALKYWGPTTTTNFPISNYEE
Q76H96________________RWTGRYEAHLWDNSCRKEGQTRKGRQVYLGGYDKEEKAARAYDLAALKYWGPSTHINFPLETYEK
![]() |
---|
Start position | End position | Sequence | Length |
---|---|---|---|
180 | 192 | ACC ACC ACC ACC A | 13 |
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain