UniGene Name: sp_v3.0_unigene134460
Length: 247 nt
![]() |
---|
>sp_v3.0_unigene134460
C |
![]() |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
![]() |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] sp|C0LGG9.2|Y5344_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein kinase At1g53440; Flags: Precursor gb|AEE32941.1| putative LRR receptor-like serine | - | - | 8.0e-14 | 50% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 46% |
Sma3 | Chromosome undetermined scaffold_394, whole genome shotgun sequence | - | - | 6.844e-06 | - |
Source | Gene names |
---|---|
Sma3 | AT4g03230; At1g11280; At1g11280/T28P6.7; At1g61390; At1g61550; At4g03230; F4C21.16; GSVIVT00008118001; GSVIVT00010083001; GSVIVT00012559001; GSVIVT00012561001; GSVIVT00012985001; GSVIVT00012993001; GSVIVT00018818001; GSVIVT00026072001; GSVIVT00026124001; |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | membrane | GO:0016020 | Cellular Component | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | metal ion transmembrane transporter activity | GO:0046873 | Molecular Function | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | cell wall macromolecule catabolic process | GO:0016998 | Biological Process | 0.0 | - |
Sma3 | metal ion transport | GO:0030001 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT1G53430.1 | Leucine-rich repeat transmembrane protein kinase chr1:19935298-19940959 FORWARD LENGTH=1030 | 5.0e-18 | 50% |
RefSeq | Arabidopsis thaliana | NP_001117479.1 | Leucine-rich repeat transmembrane protein kinase [Arabidopsis thaliana] | 6.0e-18 | 50% |
RefSeq | Populus trichocarpa | XP_002311515.1 | predicted protein, partial [Populus trichocarpa] | 7.0e-17 | 67% |
![]() |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PPW7
Fln msg: Distance to subject end: 297 aas, your sequence is shorter than subject: 82 - 702
Fln protein:
V
Protein Length:
83
Fln nts:
C
Fln Alignment:
AllPine_a_rep_c90472___HSTDNDEGEELVL--LNNRHIIFTMETLLASTKNFDNQNKLGEGGFGPVYKGTTPDGKEIAVKKLSFKSMQ
C0PPW7________________YRTGGDEGDSVLMPTIANPELIFKFDILRESTSNFKAENKLGEGGFGSVFKGVLPDGREVAVKRLFMGTRQ
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain