UniGene Name: sp_v3.0_unigene134105
Length: 230 nt
UniGene Fasta |
---|
>sp_v3.0_unigene134105
C |
Ace file of the UniGene sp_v3.0_unigene134105 |
---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
---|
Source | Descriptions | Term | Type | e value | Identity |
---|---|---|---|---|---|
AutoFact | putative receptor-like protein kinase 4 [Oryza sativa Japonica Group] dbj|BAD32133.1| putative receptor-like protein kinase 4 [Oryza sativa Japonica Group] | - | - | 3.0e-16 | 57% |
FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 69% |
Sma3 | Chromosome chr19 scaffold_4, whole genome shotgun sequence | - | - | 6.793e-09 | - |
Source | Gene names |
---|---|
Sma3 | AT5G53890; At1g65800; At3g24540; At5g53890; GSVIVT00004742001; GSVIVT00004743001; GSVIVT00005156001; GSVIVT00005183001; GSVIVT00005602001; GSVIVT00005605001; GSVIVT00010206001; GSVIVT00010903001; GSVIVT00010908001; GSVIVT00011366001; GSVIVT00011371001; GS |
Source | GOs | Term | Type | e value | Identity |
---|---|---|---|---|---|
Sma3 | plasma membrane | GO:0005886 | Cellular Component | 0.0 | - |
Sma3 | chloroplast | GO:0009507 | Cellular Component | 0.0 | - |
Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
Sma3 | peptide receptor activity | GO:0001653 | Molecular Function | 0.0 | - |
Sma3 | chitinase activity | GO:0004568 | Molecular Function | 0.0 | - |
Sma3 | protein serine/threonine kinase activity | GO:0004674 | Molecular Function | 0.0 | - |
Sma3 | protein tyrosine kinase activity | GO:0004713 | Molecular Function | 0.0 | - |
Sma3 | receptor activity | GO:0004872 | Molecular Function | 0.0 | - |
Sma3 | structural constituent of cell wall | GO:0005199 | Molecular Function | 0.0 | - |
Sma3 | protein binding | GO:0005515 | Molecular Function | 0.0 | - |
Sma3 | ATP binding | GO:0005524 | Molecular Function | 0.0 | - |
Sma3 | sugar binding | GO:0005529 | Molecular Function | 0.0 | - |
Sma3 | cation binding | GO:0043169 | Molecular Function | 0.0 | - |
Sma3 | chitin catabolic process | GO:0006032 | Biological Process | 0.0 | - |
Sma3 | protein phosphorylation | GO:0006468 | Biological Process | 0.0 | - |
Sma3 | response to wounding | GO:0009611 | Biological Process | 0.0 | - |
Sma3 | recognition of pollen | GO:0048544 | Biological Process | 0.0 | - |
Source | Species | ID | Description | e value | Identity |
---|---|---|---|---|---|
ATG | Arabidoptis thaliana | AT5G11020.1 | Protein kinase superfamily protein chr5:3486439-3488983 REVERSE LENGTH=433 | 6.0e-20 | 52% |
RefSeq | Arabidopsis thaliana | NP_850806.2 | ser/thr specific protein kinase-like protein [Arabidopsis thaliana] | 8.0e-20 | 52% |
RefSeq | Populus trichocarpa | XP_002324316.1 | predicted protein, partial [Populus trichocarpa] | 1.0e-22 | 57% |
Full-Lengther Next Prediction |
---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: D5AA69
Fln msg: Distance to subject end: 259 aas, your sequence is shorter than subject: 76 - 587
Fln protein:
V
Protein Length:
77
Fln nts:
C
Fln Alignment:
AllPine_a_rep_c89975___LAVTQNNFSSNNILGEGGFGCVYKAMFDDDSFAAVKKLDEGSRQAEHEFQNEVELMSKIRHPNLVSLLGFCTH
D5AA69________________LQAATNNFSSYNFLGKGGFGSVYRAQFHDDFCVAVKMLDENRKQADNEFQSEVELMSKIRHPNLVSLLGFCVH
Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain