UniGene Name: sp_v3.0_unigene133913
Length: 214 nt
UniGene Fasta
|
|---|
| >sp_v3.0_unigene133913
A |
Ace file of the UniGene sp_v3.0_unigene133913
|
|---|
If you push the Download ace button, you will download an ace file of this UniGene.
To watch this ACE file you will need an ACE viewer program as Tablet:
Go to the Tablet ACE viewer Web
Annotations |
|---|
| Source | Descriptions | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| AutoFact | Flavonoid 3'-hydroxylase n=8 Tax=Andropogoneae RepID=Q0Z7U8_SORBI | - | - | 6.0e-20 | 65% |
| FL-Next | tr=Putative uncharacterized protein; Picea sitchensis (Sitka spruce) (Pinus sitchensis). | - | - | 0.0 | 82% |
| Sma3 | Flavonoid 3'-hydroxylase | - | - | 0.0 | - |
| Source | ECs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonoid 3'-monooxygenase. | EC:1.14.13.21 | - | 1.869e-09 | - |
| Source | KEGGs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Flavonoid biosynthesis | 00941 | 1.869e-09 | % | |
| Sma3 | Flavone and flavonol biosynthesis | 00944 | 1.869e-09 | % | |
| Sma3 | Biosynthesis of phenylpropanoids | 01061 | 1.869e-09 | % | |
| Sma3 | Metabolic pathways | 01100 | 1.869e-09 | % | |
| Sma3 | Biosynthesis of secondary metabolites | 01110 | 1.869e-09 | % |
| Source | Gene names |
|---|---|
| Sma3 | 5'H; AT4g31940; At1g66540; At4g31940; At5g07990; CYP736A3v2; CYP736A5v1; CYP75; CYP75A12|F3'5'H1; CYP75A13; CYP75A6; CYP75B1; CYP75B2; CYP80B2; CYP80E2; CYP81R3; CYP82; CYP82B1; CYP82C12Pv1; CYP82C14P; CYP82C15v1; CYP82C15v2; CYP82C5v1; CYP82K1; CYP82L1; |
| Source | GOs | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | endoplasmic reticulum membrane | GO:0005789 | Cellular Component | 0.0 | - |
| Sma3 | integral to membrane | GO:0016021 | Cellular Component | 0.0 | - |
| Sma3 | monooxygenase activity | GO:0004497 | Molecular Function | 0.0 | - |
| Sma3 | iron ion binding | GO:0005506 | Molecular Function | 0.0 | - |
| Sma3 | electron carrier activity | GO:0009055 | Molecular Function | 0.0 | - |
| Sma3 | flavonoid 3'-monooxygenase activity | GO:0016711 | Molecular Function | 0.0 | - |
| Sma3 | heme binding | GO:0020037 | Molecular Function | 0.0 | - |
| Sma3 | flavonoid 3',5'-hydroxylase activity | GO:0033772 | Molecular Function | 0.0 | - |
| Sma3 | flavonoid biosynthetic process | GO:0009813 | Biological Process | 0.0 | - |
| Sma3 | oxidation-reduction process | GO:0055114 | Biological Process | 0.0 | - |
| Source | InterPros | Term | Type | e value | Identity |
|---|---|---|---|---|---|
| Sma3 | Cytochrome P450 | IPR001128 | - | 0.0 | - |
| Sma3 | Aminoacyl-tRNA synthetase, class I, conserved site | IPR001412 | - | 0.0 | - |
| Sma3 | Cytochrome P450, E-class, group I | IPR002401 | - | 0.0 | - |
| Sma3 | Pentatricopeptide repeat | IPR002885 | - | 0.0 | - |
| Sma3 | Cytochrome P450, conserved site | IPR017972 | - | 0.0 | - |
| Sma3 | IPR017973 | - | 0.0 | - | |
| Sma3 | EF-Hand 1, calcium-binding site | IPR018247 | - | 0.0 | - |
| Source | Species | ID | Description | e value | Identity |
|---|---|---|---|---|---|
| ATG | Arabidoptis thaliana | AT5G07990.1 | TT7, CYP75B1, D501 Cytochrome P450 superfamily protein chr5:2560437-2562859 FORWARD LENGTH=513 | 7.0e-23 | 62% |
| RefSeq | Arabidopsis thaliana | NP_196416.1 | Flavonoid 3'-monooxygenase [Arabidopsis thaliana] | 9.0e-23 | 62% |
| RefSeq | Populus trichocarpa | XP_002334557.1 | cytochrome P450 [Populus trichocarpa] | 6.0e-24 | 60% |
Full-Lengther Next Prediction |
|---|
Fln status: Internal
Fln database: coniferopsida.fasta
Fln subject: C0PQV6
Fln msg: Distance to subject end: 101 aas, your sequence is shorter than subject: 70 - 517
Fln protein:
A
Protein Length:
71
Fln nts:
A
Fln Alignment:
AllPine_a_rep_c89681___LVGMGRMVGESDLPRLVYLQAVVKETLRLHPPGPLSLPRISMERCNLLGYEIPGGTHLLVNIWAIGRDP
C0PQV6________________VVGMGRMVHESDLPRLVYLQAVVKETLRLHPPGPLLLPHISIETCNVLGYKIPSGTRLLVNVWAIGRNP

Biología Molecular y Biotecnología de Plantas, Facultad de Ciencias y Plataforma Andaluza de Bioinformática, Universidad de Málaga, E-29071 Málaga, Spain
UniGene Fasta